Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
23299
Gene name Gene Name - the full gene name approved by the HGNC.
BICD cargo adaptor 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
BICD2
Synonyms (NCBI Gene) Gene synonyms aliases
SMALED2, SMALED2A, SMALED2B, bA526D8.1
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9q22.31
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is one of two human homologs of Drosophila bicaudal-D and a member of the Bicoid family. It has been implicated in dynein-mediated, minus end-directed motility along microtubules. It has also been reported to be a phosphorylation target of NIMA
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs141414055 G>A,C Conflicting-interpretations-of-pathogenicity Coding sequence variant, synonymous variant, missense variant
rs192669216 G>A,T Conflicting-interpretations-of-pathogenicity, uncertain-significance Missense variant, coding sequence variant
rs371707778 G>A Pathogenic, likely-pathogenic Missense variant, coding sequence variant
rs398123028 G>A Pathogenic, not-provided Missense variant, coding sequence variant
rs398123029 T>G Pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT023191 hsa-miR-124-3p Microarray 18668037
MIRT028312 hsa-miR-32-5p Sequencing 20371350
MIRT041505 hsa-miR-193b-3p CLASH 23622248
MIRT039848 hsa-miR-615-3p CLASH 23622248
MIRT039040 hsa-miR-766-3p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 16417406, 20386726, 23664119, 24482476, 28514442, 32296183
GO:0005634 Component Nucleus IEA
GO:0005635 Component Nuclear envelope IDA 20386726
GO:0005635 Component Nuclear envelope IEA
GO:0005642 Component Annulate lamellae IDA 20386726
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609797 17208 ENSG00000185963
Protein
UniProt ID Q8TD16
Protein name Protein bicaudal D homolog 2 (Bic-D 2)
Protein function Acts as an adapter protein linking the dynein motor complex to various cargos and converts dynein from a non-processive to a highly processive motor in the presence of dynactin. Facilitates and stabilizes the interaction between dynein and dynac
PDB 6OFP , 6PSE
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09730 BicD 83 801 Microtubule-associated protein Bicaudal-D Coiled-coil
Tissue specificity TISSUE SPECIFICITY: Ubiquitous.
Sequence
MSAPSEEEEYARLVMEAQPEWLRAEVKRLSHELAETTREKIQAAEYGLAVLEEKHQLKLQ
FEELEVDYEAIRSEMEQLKEAFGQAHTNHKKVAADGESREESLIQESASKEQYYVRKVLE
LQTELKQLRNVLTNTQSENERLASVAQELKEINQNVEIQRGRLRDDIKEYKFREARLLQD
YSELEEENISLQKQVSVLRQNQVEFEGLKHEIKRLEEETEYLNSQLEDAIRLKEISERQL
EEALETLKTEREQKNSLRKELSHYMSINDSFYTSHLHVSLDGLKFSDDAAEPNNDAEALV
NGFEHGGLAKLPLDNKTSTPKKEGLAPPSPSLVSDLLSELNISEIQKLKQQLMQMEREKA
GLLATLQDTQKQLEHTRGSLSEQQEKVTRLTENLSALRRLQASKERQTALDNEKDRDSHE
DGDYYEVDINGPEILACKYHVAVAEAGELREQLKALRSTHEAREAQHAEEKGRYEAEGQA
LTEKVSLLEKASRQDRELLARLEKELKKVSDVAGETQGSLSVAQDELVTFSEELANLYHH
VCMCNNETPNRVMLDYYREGQGGAGRTSPGGRTSPEARGRRSPILLPKGLLAPEAGRADG
GTGDSSPSPGSSLPSPLSDPRREPMNIYNLIAIIRDQIKHLQAAVDRTTELSRQRIASQE
LGPAVDKDKEALMEEILKLKSLLSTKREQITTLRTVLKANKQTAEVALANLKSKYENEKA
MVTETMMKLRNELKALKEDAATFSSLRAMFATRCDEYITQLDEMQRQLAAAEDEKKTLNS
LLRMAIQQKLALTQRLELLEL
DHEQTRRGRAKAAPKTKPATPSL
Sequence length 824
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Viral life cycle - HIV-1   COPI-independent Golgi-to-ER retrograde traffic
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Distal Hereditary Motor Neuronopathy Neuronopathy, distal hereditary motor, autosomal dominant rs1587668798, rs1587671674, rs398123028 N/A
Spinal Muscular Atrophy Autosomal dominant childhood-onset proximal spinal muscular atrophy with contractures, spinal muscular atrophy, lower extremity-predominant, 2b, prenatal onset, autosomal dominant, spinal muscular atrophy rs1587668769, rs797045412, rs1263279945, rs1587668748, rs1064795760, rs1131691347, rs1564061982, rs398123028, rs1587671674, rs1587668077, rs371707778, rs398123030 N/A
distal myopathy Distal myopathy rs398123028 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Charcot-Marie-Tooth Disease Charcot-Marie-Tooth Disease N/A N/A ClinVar
Diabetes Type 2 diabetes N/A N/A GWAS
Hereditary spastic paraplegia Hereditary spastic paraplegia, Hereditary spastic paraplegia 3A N/A N/A ClinVar
Spastic Paraplegia spastic paraplegia N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 32360590
Allergic Fungal Sinusitis Associate 29253858
Amyotrophic Lateral Sclerosis Associate 37849306
Arthrogryposis Associate 25497877, 28635954, 30054298
Atrophy Associate 30054298
Brain Diseases Associate 36930595
Breast Neoplasms Associate 31965981
Cardiomegaly Associate 33122805
Central Nervous System Vascular Malformations Associate 35896821, 36930595
Cerebellar Hypoplasia Associate 35896821