Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
23221
Gene name Gene Name - the full gene name approved by the HGNC.
Rho related BTB domain containing 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RHOBTB2
Synonyms (NCBI Gene) Gene synonyms aliases
DBC2, DEE64, EIEE64, p83
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8p21.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a small Rho GTPase and a candidate tumor suppressor. The encoded protein interacts with the cullin-3 protein, a ubiquitin E3 ligase necessary for mitotic cell division. This protein inhibits the growth and spread of som
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs1554504656 C>G Likely-pathogenic Coding sequence variant, missense variant
rs1554504663 G>A Pathogenic-likely-pathogenic Coding sequence variant, missense variant
rs1554504678 A>G Likely-pathogenic, uncertain-significance Coding sequence variant, missense variant
rs1554504681 C>T Likely-pathogenic Coding sequence variant, missense variant
rs1554504684 G>A Pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT044286 hsa-miR-106b-5p CLASH 23622248
MIRT039445 hsa-miR-421 CLASH 23622248
MIRT1305437 hsa-miR-1285 CLIP-seq
MIRT1305438 hsa-miR-1293 CLIP-seq
MIRT1305439 hsa-miR-1470 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0003924 Function GTPase activity IBA
GO:0003924 Function GTPase activity IEA
GO:0005515 Function Protein binding IPI 15107402, 26517842, 27941885, 29276004
GO:0005525 Function GTP binding IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607352 18756 ENSG00000008853
Protein
UniProt ID Q9BYZ6
Protein name Rho-related BTB domain-containing protein 2 (Deleted in breast cancer 2 gene protein) (p83)
Protein function Regulator of cell proliferation and apoptosis (PubMed:21801820). It likely functions as a substrate-adapter that recruits key substrates, e.g. MSI2, to CUL3-based ubiquitin ligase complexes for degradation (PubMed:15107402, PubMed:27941885). Req
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00071 Ras 16 209 Ras family Domain
PF00651 BTB 381 472 BTB/POZ domain Domain
PF00651 BTB 490 598 BTB/POZ domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous, with highest levels in neural tissues. Expression is also detected in fetal lung, heart, and brain. {ECO:0000269|PubMed:12426103}.
Sequence
MDSDMDYERPNVETIKCVVVGDNAVGKTRLICARACNATLTQYQLLATHVPTVWAIDQYR
VCQEVLERSRDVVDDVSVSLRLWDTFGDHHKDRRFAYGRSDVVVLCFSIANPNSLHHVKT
MWYPEIKHFCPRAPVILVGCQLDLRYADLEAVNRARRPLARPIKPNEILPPEKGREVAKE
LGIPYYETSVVAQFGIKDVFDNAIRAALI
SRRHLQFWKSHLRNVQRPLLQAPFLPPKPPP
PIIVVPDPPSSSEECPAHLLEDPLCADVILVLQERVRIFAHKIYLSTSSSKFYDLFLMDL
SEGELGGPSEPGGTHPEDHQGHSDQHHHHHHHHHGRDFLLRAASFDVCESVDEAGGSGPA
GLRASTSDGILRGNGTGYLPGRGRVLSSWSRAFVSIQEEMAEDPLTYKSRLMVVVKMDSS
IQPGPFRAVLKYLYTGELDENERDLMHIAHIAELLEVFDLRMMVANILNNEA
FMNQEITK
AFHVRRTNRVKECLAKGTFSDVTFILDDGTISAHKPLLISSCDWMAAMFGGPFVESSTRE
VVFPYTSKSCMRAVLEYLYTGMFTSSPDLDDMKLIILANRLCLPHLVALTEQYTVTGL
ME
ATQMMVDIDGDVLVFLELAQFHCAYQLADWCLHHICTNYNNVCRKFPRDMKAMSPENQEY
FEKHRWPPVWYLKEEDHYQRARKEREKEDYLHLKRQPKRRWLFWNSPSSPSSSAASSSSP
SSSSAVV
Sequence length 727
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Ubiquitin mediated proteolysis   Rho GTPase cycle
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Developmental And Epileptic Encephalopathy Developmental and epileptic encephalopathy, 64 rs1554504678, rs1554504663, rs1554504684, rs1554504656, rs1563292586, rs1585190351, rs1554504681 N/A
Rett Syndrome rett syndrome rs1554504681 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Carcinoma Basal cell carcinoma N/A N/A GWAS
Neurodevelopmental Disorders complex neurodevelopmental disorder N/A N/A GenCC
Renal Carcinoma Renal cell carcinoma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Inhibit 22901165
Alternating hemiplegia of childhood Associate 33504645
Arthritis Associate 8567889
Ataxia Associate 33504645
Breast Neoplasms Associate 12370419, 17023000, 17517369, 17617377, 24485767, 27941885, 35698915
Breast Neoplasms Inhibit 20930524, 24608665
Developmental Disabilities Associate 26740508, 37165955
Dystonia Associate 33504645
Epilepsy Associate 33504645
Epileptic Encephalopathy Early Infantile 3 Associate 31957018, 35315256, 37165955