Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
23194
Gene name Gene Name - the full gene name approved by the HGNC.
F-box and leucine rich repeat protein 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FBXL7
Synonyms (NCBI Gene) Gene synonyms aliases
FBL6, FBL7
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5p15.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the F-box protein family which is characterized by a 42-48 amino acid motif, the F-box, which binds to the S-phase kinase-associated protein 1 (Skp1) protein. The F-box proteins constitute one of the four subunits of E3 ubiqu
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT537453 hsa-miR-106a-5p PAR-CLIP 22012620
MIRT537452 hsa-miR-106b-5p PAR-CLIP 22012620
MIRT537451 hsa-miR-17-5p PAR-CLIP 22012620
MIRT537450 hsa-miR-20a-5p PAR-CLIP 22012620
MIRT537449 hsa-miR-20b-5p PAR-CLIP 22012620
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000086 Process G2/M transition of mitotic cell cycle IEA
GO:0000086 Process G2/M transition of mitotic cell cycle ISS
GO:0000151 Component Ubiquitin ligase complex NAS 10531035
GO:0000209 Process Protein polyubiquitination IDA 25778398
GO:0000209 Process Protein polyubiquitination IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605656 13604 ENSG00000183580
Protein
UniProt ID Q9UJT9
Protein name F-box/LRR-repeat protein 7 (F-box and leucine-rich repeat protein 7) (F-box protein FBL6/FBL7)
Protein function Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex (PubMed:25778398). During mitosis, it mediates the ubiquitination and subsequent proteasomal degradation of AURKA, causing mitotic arrest (By
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00646 F-box 112 159 F-box domain Domain
PF13516 LRR_6 296 320 Leucine Rich repeat Repeat
PF13516 LRR_6 400 424 Leucine Rich repeat Repeat
PF13516 LRR_6 426 447 Leucine Rich repeat Repeat
Sequence
MGANNGKQYGSEGKGSSSISSDVSSSTDHTPTKAQKNVATSEDSDLSMRTLSTPSPALIC
PPNLPGFQNGRGSSTSSSSITGETVAMVHSPPPTRLTHPLIRLASRPQKEQASIDRLPDH
SMVQIFSFLPTNQLCRCARVCRRWYNLAWDPRLWRTIRL
TGETINVDRALKVLTRRLCQD
TPNVCLMLETVTVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNL
EHLDVSGCSKVTCISLTREASIKLSPLHGKQISIRYLDMTDCFVLEDEGLHTIAAHCTQL
THLYLRRCVRLTDEGLRYLV
IYCASIKELSVSDCRFVSDFGLREIAKLESRLRYLSIAHC
GRVTDVGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSLDIGKCPLVSDTGL
ECLA
LNCFNLKRLSLKSCESITGQGLQIVAANCFDLQTLNVQDCEVSVEALRFVKRHCKR
CVIEHTNPAFF
Sequence length 491
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    FBXL7 down-regulates AURKA during mitotic entry and in early mitosis
Neddylation
Antigen processing: Ubiquitination & Proteasome degradation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Asthma (corticosteroid response) N/A N/A GWAS
Lung adenocarcinoma Familial lung adenocarcinoma N/A N/A GWAS
Oligodendroglioma Oligodendroglioma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Asthma Associate 24486069, 31095684, 32119686
Breast Neoplasms Associate 20418484
Carcinoma Non Small Cell Lung Associate 37179372
Esophageal Neoplasms Associate 35887149
Hemangioma capillary infantile Associate 36181115
Hereditary Breast and Ovarian Cancer Syndrome Associate 22759382
Hypoxia Associate 37179372
Ige Responsiveness Atopic Associate 30584054
Insulin Resistance Associate 23628382
Neoplasm Metastasis Associate 37179372