Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	23194
Gene name	F-box and leucine rich repeat protein 7
Gene symbol	FBXL7
Synonyms (NCBI Gene)	FBL6FBL7
Chromosome	5
Chromosome location	5p15.1
Summary	This gene encodes a member of the F-box protein family which is characterized by a 42-48 amino acid motif, the F-box, which binds to the S-phase kinase-associated protein 1 (Skp1) protein. The F-box proteins constitute one of the four subunits of E3 ubiqu

205

Show/Hide all (205)

miRTarBase ID	miRNA	Experiments	Reference
MIRT537453	hsa-miR-106a-5p	PAR-CLIP	22012620
MIRT537452	hsa-miR-106b-5p	PAR-CLIP	22012620
MIRT537451	hsa-miR-17-5p	PAR-CLIP	22012620
MIRT537450	hsa-miR-20a-5p	PAR-CLIP	22012620
MIRT537449	hsa-miR-20b-5p	PAR-CLIP	22012620
MIRT537448	hsa-miR-519d-3p	PAR-CLIP	22012620
MIRT537447	hsa-miR-526b-3p	PAR-CLIP	22012620
MIRT537446	hsa-miR-93-5p	PAR-CLIP	22012620
MIRT537445	hsa-miR-302a-3p	PAR-CLIP	22012620
MIRT537444	hsa-miR-302b-3p	PAR-CLIP	22012620
MIRT537443	hsa-miR-302c-3p	PAR-CLIP	22012620
MIRT537442	hsa-miR-302d-3p	PAR-CLIP	22012620
MIRT537441	hsa-miR-302e	PAR-CLIP	22012620
MIRT537440	hsa-miR-372-3p	PAR-CLIP	22012620
MIRT537439	hsa-miR-373-3p	PAR-CLIP	22012620
MIRT537438	hsa-miR-520a-3p	PAR-CLIP	22012620
MIRT537437	hsa-miR-520b	PAR-CLIP	22012620
MIRT537436	hsa-miR-520c-3p	PAR-CLIP	22012620
MIRT537435	hsa-miR-520d-3p	PAR-CLIP	22012620
MIRT537434	hsa-miR-520e	PAR-CLIP	22012620
MIRT537433	hsa-miR-5579-5p	PAR-CLIP	22012620
MIRT537432	hsa-miR-4461	PAR-CLIP	22012620
MIRT537431	hsa-miR-520g-3p	PAR-CLIP	22012620
MIRT537430	hsa-miR-520h	PAR-CLIP	22012620
MIRT537429	hsa-miR-219a-1-3p	PAR-CLIP	22012620
MIRT537428	hsa-miR-571	PAR-CLIP	22012620
MIRT537427	hsa-miR-31-3p	PAR-CLIP	22012620
MIRT537426	hsa-miR-5681b	PAR-CLIP	22012620
MIRT537425	hsa-miR-518a-5p	PAR-CLIP	22012620
MIRT537424	hsa-miR-527	PAR-CLIP	22012620
MIRT537423	hsa-miR-3912-5p	PAR-CLIP	22012620
MIRT537453	hsa-miR-106a-5p	PAR-CLIP	22012620
MIRT537452	hsa-miR-106b-5p	PAR-CLIP	22012620
MIRT537451	hsa-miR-17-5p	PAR-CLIP	22012620
MIRT537450	hsa-miR-20a-5p	PAR-CLIP	22012620
MIRT537449	hsa-miR-20b-5p	PAR-CLIP	22012620
MIRT537448	hsa-miR-519d-3p	PAR-CLIP	22012620
MIRT537447	hsa-miR-526b-3p	PAR-CLIP	22012620
MIRT537446	hsa-miR-93-5p	PAR-CLIP	22012620
MIRT537445	hsa-miR-302a-3p	PAR-CLIP	22012620
MIRT537444	hsa-miR-302b-3p	PAR-CLIP	22012620
MIRT537443	hsa-miR-302c-3p	PAR-CLIP	22012620
MIRT537442	hsa-miR-302d-3p	PAR-CLIP	22012620
MIRT537441	hsa-miR-302e	PAR-CLIP	22012620
MIRT537440	hsa-miR-372-3p	PAR-CLIP	22012620
MIRT537439	hsa-miR-373-3p	PAR-CLIP	22012620
MIRT537438	hsa-miR-520a-3p	PAR-CLIP	22012620
MIRT537437	hsa-miR-520b	PAR-CLIP	22012620
MIRT537436	hsa-miR-520c-3p	PAR-CLIP	22012620
MIRT537435	hsa-miR-520d-3p	PAR-CLIP	22012620
MIRT537434	hsa-miR-520e	PAR-CLIP	22012620
MIRT537433	hsa-miR-5579-5p	PAR-CLIP	22012620
MIRT537432	hsa-miR-4461	PAR-CLIP	22012620
MIRT537431	hsa-miR-520g-3p	PAR-CLIP	22012620
MIRT537430	hsa-miR-520h	PAR-CLIP	22012620
MIRT537429	hsa-miR-219a-1-3p	PAR-CLIP	22012620
MIRT537428	hsa-miR-571	PAR-CLIP	22012620
MIRT537427	hsa-miR-31-3p	PAR-CLIP	22012620
MIRT537426	hsa-miR-5681b	PAR-CLIP	22012620
MIRT537425	hsa-miR-518a-5p	PAR-CLIP	22012620
MIRT537424	hsa-miR-527	PAR-CLIP	22012620
MIRT537423	hsa-miR-3912-5p	PAR-CLIP	22012620
MIRT991167	hsa-miR-1184	CLIP-seq
MIRT991168	hsa-miR-1193	CLIP-seq
MIRT991169	hsa-miR-1285	CLIP-seq
MIRT991170	hsa-miR-1287	CLIP-seq
MIRT991171	hsa-miR-132	CLIP-seq
MIRT991172	hsa-miR-1343	CLIP-seq
MIRT991173	hsa-miR-141	CLIP-seq
MIRT991174	hsa-miR-148a	CLIP-seq
MIRT991175	hsa-miR-148b	CLIP-seq
MIRT991176	hsa-miR-152	CLIP-seq
MIRT991177	hsa-miR-200a	CLIP-seq
MIRT991178	hsa-miR-212	CLIP-seq
MIRT991179	hsa-miR-3135b	CLIP-seq
MIRT991180	hsa-miR-3160-3p	CLIP-seq
MIRT991181	hsa-miR-3187-5p	CLIP-seq
MIRT991182	hsa-miR-3689a-3p	CLIP-seq
MIRT991183	hsa-miR-3689c	CLIP-seq
MIRT991184	hsa-miR-3915	CLIP-seq
MIRT991185	hsa-miR-3928	CLIP-seq
MIRT991186	hsa-miR-4276	CLIP-seq
MIRT991187	hsa-miR-4297	CLIP-seq
MIRT991188	hsa-miR-4302	CLIP-seq
MIRT991189	hsa-miR-4455	CLIP-seq
MIRT991190	hsa-miR-4648	CLIP-seq
MIRT991191	hsa-miR-4654	CLIP-seq
MIRT991192	hsa-miR-4690-3p	CLIP-seq
MIRT991193	hsa-miR-4718	CLIP-seq
MIRT991194	hsa-miR-4728-5p	CLIP-seq
MIRT991195	hsa-miR-4731-5p	CLIP-seq
MIRT991196	hsa-miR-4769-5p	CLIP-seq
MIRT991197	hsa-miR-488	CLIP-seq
MIRT991198	hsa-miR-509-3p	CLIP-seq
MIRT991199	hsa-miR-512-3p	CLIP-seq
MIRT991200	hsa-miR-570	CLIP-seq
MIRT991201	hsa-miR-609	CLIP-seq
MIRT991202	hsa-miR-612	CLIP-seq
MIRT991203	hsa-miR-671-5p	CLIP-seq
MIRT991204	hsa-miR-7	CLIP-seq
MIRT991167	hsa-miR-1184	CLIP-seq
MIRT1993913	hsa-miR-1253	CLIP-seq
MIRT1993914	hsa-miR-1976	CLIP-seq
MIRT1993915	hsa-miR-2355-5p	CLIP-seq
MIRT1993916	hsa-miR-3151	CLIP-seq
MIRT1993917	hsa-miR-3165	CLIP-seq
MIRT991192	hsa-miR-4690-3p	CLIP-seq
MIRT991204	hsa-miR-7	CLIP-seq
MIRT1993918	hsa-miR-9	CLIP-seq
MIRT2227955	hsa-miR-1182	CLIP-seq
MIRT991167	hsa-miR-1184	CLIP-seq
MIRT991170	hsa-miR-1287	CLIP-seq
MIRT991174	hsa-miR-148a	CLIP-seq
MIRT991175	hsa-miR-148b	CLIP-seq
MIRT991176	hsa-miR-152	CLIP-seq
MIRT1993914	hsa-miR-1976	CLIP-seq
MIRT1993915	hsa-miR-2355-5p	CLIP-seq
MIRT991179	hsa-miR-3135b	CLIP-seq
MIRT2227956	hsa-miR-3140-5p	CLIP-seq
MIRT991186	hsa-miR-4276	CLIP-seq
MIRT991192	hsa-miR-4690-3p	CLIP-seq
MIRT991199	hsa-miR-512-3p	CLIP-seq
MIRT991203	hsa-miR-671-5p	CLIP-seq
MIRT991167	hsa-miR-1184	CLIP-seq
MIRT991170	hsa-miR-1287	CLIP-seq
MIRT991174	hsa-miR-148a	CLIP-seq
MIRT991175	hsa-miR-148b	CLIP-seq
MIRT991176	hsa-miR-152	CLIP-seq
MIRT991179	hsa-miR-3135b	CLIP-seq
MIRT991186	hsa-miR-4276	CLIP-seq
MIRT991192	hsa-miR-4690-3p	CLIP-seq
MIRT991199	hsa-miR-512-3p	CLIP-seq
MIRT991203	hsa-miR-671-5p	CLIP-seq
MIRT2428846	hsa-miR-1915	CLIP-seq
MIRT2428847	hsa-miR-3159	CLIP-seq
MIRT2428848	hsa-miR-3162-5p	CLIP-seq
MIRT2428849	hsa-miR-3667-5p	CLIP-seq
MIRT2428850	hsa-miR-3918	CLIP-seq
MIRT2428851	hsa-miR-4685-5p	CLIP-seq
MIRT991167	hsa-miR-1184	CLIP-seq
MIRT991170	hsa-miR-1287	CLIP-seq
MIRT991174	hsa-miR-148a	CLIP-seq
MIRT991175	hsa-miR-148b	CLIP-seq
MIRT991176	hsa-miR-152	CLIP-seq
MIRT991179	hsa-miR-3135b	CLIP-seq
MIRT991186	hsa-miR-4276	CLIP-seq
MIRT991192	hsa-miR-4690-3p	CLIP-seq
MIRT991199	hsa-miR-512-3p	CLIP-seq
MIRT991203	hsa-miR-671-5p	CLIP-seq
MIRT2449504	hsa-miR-19a	CLIP-seq
MIRT2449505	hsa-miR-19b	CLIP-seq
MIRT2449506	hsa-miR-3934	CLIP-seq
MIRT2449507	hsa-miR-4708-3p	CLIP-seq
MIRT2449508	hsa-miR-4755-3p	CLIP-seq
MIRT2449504	hsa-miR-19a	CLIP-seq
MIRT2449505	hsa-miR-19b	CLIP-seq
MIRT2449506	hsa-miR-3934	CLIP-seq
MIRT2449507	hsa-miR-4708-3p	CLIP-seq
MIRT2449508	hsa-miR-4755-3p	CLIP-seq
MIRT2227955	hsa-miR-1182	CLIP-seq
MIRT2531467	hsa-miR-224	CLIP-seq
MIRT2531468	hsa-miR-3134	CLIP-seq
MIRT2227956	hsa-miR-3140-5p	CLIP-seq
MIRT991180	hsa-miR-3160-3p	CLIP-seq
MIRT2531469	hsa-miR-3671	CLIP-seq
MIRT2531470	hsa-miR-3682-3p	CLIP-seq
MIRT2531471	hsa-miR-4457	CLIP-seq
MIRT2531472	hsa-miR-4502	CLIP-seq
MIRT2531473	hsa-miR-4534	CLIP-seq
MIRT2531474	hsa-miR-4679	CLIP-seq
MIRT2531475	hsa-miR-4738-3p	CLIP-seq
MIRT2531476	hsa-miR-4762-3p	CLIP-seq
MIRT2531477	hsa-miR-513b	CLIP-seq
MIRT2531478	hsa-miR-607	CLIP-seq
MIRT2227955	hsa-miR-1182	CLIP-seq
MIRT2680857	hsa-miR-133a	CLIP-seq
MIRT2680858	hsa-miR-133b	CLIP-seq
MIRT2531467	hsa-miR-224	CLIP-seq
MIRT1993915	hsa-miR-2355-5p	CLIP-seq
MIRT2531468	hsa-miR-3134	CLIP-seq
MIRT2227956	hsa-miR-3140-5p	CLIP-seq
MIRT991180	hsa-miR-3160-3p	CLIP-seq
MIRT2531469	hsa-miR-3671	CLIP-seq
MIRT2680859	hsa-miR-3679-3p	CLIP-seq
MIRT2531470	hsa-miR-3682-3p	CLIP-seq
MIRT991184	hsa-miR-3915	CLIP-seq
MIRT991185	hsa-miR-3928	CLIP-seq
MIRT2531471	hsa-miR-4457	CLIP-seq
MIRT2680860	hsa-miR-4487	CLIP-seq
MIRT2531472	hsa-miR-4502	CLIP-seq
MIRT2531473	hsa-miR-4534	CLIP-seq
MIRT2680861	hsa-miR-4663	CLIP-seq
MIRT2531474	hsa-miR-4679	CLIP-seq
MIRT2680862	hsa-miR-4686	CLIP-seq
MIRT2531475	hsa-miR-4738-3p	CLIP-seq
MIRT2531476	hsa-miR-4762-3p	CLIP-seq
MIRT2680863	hsa-miR-4786-5p	CLIP-seq
MIRT2531477	hsa-miR-513b	CLIP-seq
MIRT2680864	hsa-miR-515-5p	CLIP-seq
MIRT2680865	hsa-miR-548c-3p	CLIP-seq
MIRT2680866	hsa-miR-558	CLIP-seq
MIRT2531478	hsa-miR-607	CLIP-seq
MIRT2680867	hsa-miR-659	CLIP-seq
MIRT2680868	hsa-miR-769-5p	CLIP-seq
MIRT1993918	hsa-miR-9	CLIP-seq

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000086	Process	G2/M transition of mitotic cell cycle	IEA
GO:0000086	Process	G2/M transition of mitotic cell cycle	ISS
GO:0000151	Component	Ubiquitin ligase complex	NAS	10531035
GO:0000209	Process	Protein polyubiquitination	IDA	25778398
GO:0000209	Process	Protein polyubiquitination	IEA
GO:0000209	Process	Protein polyubiquitination	IMP	28218735
GO:0000278	Process	Mitotic cell cycle	IEA
GO:0000278	Process	Mitotic cell cycle	ISS
GO:0005515	Function	Protein binding	IPI	25778398, 28218735, 32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IEA
GO:0005813	Component	Centrosome	ISS
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	NAS	10531035
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016567	Process	Protein ubiquitination	ISS
GO:0019005	Component	SCF ubiquitin ligase complex	IBA
GO:0019005	Component	SCF ubiquitin ligase complex	IDA	25778398
GO:0019005	Component	SCF ubiquitin ligase complex	IEA
GO:0019005	Component	SCF ubiquitin ligase complex	ISS
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IBA
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IDA	25778398
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IEA
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IMP	28218735
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	ISS
GO:0051301	Process	Cell division	IEA

MIM	HGNC	e!Ensembl
605656	13604	ENSG00000183580

Q9UJT9

Protein name

F-box/LRR-repeat protein 7 (F-box and leucine-rich repeat protein 7) (F-box protein FBL6/FBL7)

Protein function

Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex (PubMed:25778398). During mitosis, it mediates the ubiquitination and subsequent proteasomal degradation of AURKA, causing mitotic arrest (By

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00646	F-box	112 → 159	F-box domain	Domain
PF13516	LRR_6	296 → 320	Leucine Rich repeat	Repeat
PF13516	LRR_6	400 → 424	Leucine Rich repeat	Repeat
PF13516	LRR_6	426 → 447	Leucine Rich repeat	Repeat

Sequence

MGANNGKQYGSEGKGSSSISSDVSSSTDHTPTKAQKNVATSEDSDLSMRTLSTPSPALIC
PPNLPGFQNGRGSSTSSSSITGETVAMVHSPPPTRLTHPLIRLASRPQKEQASIDRLPDH
SMVQIFSFLPTNQLCRCARVCRRWYNLAWDPRLWRTIRLTGETINVDRALKVLTRRLCQD
TPNVCLMLETVTVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNL
EHLDVSGCSKVTCISLTREASIKLSPLHGKQISIRYLDMTDCFVLEDEGLHTIAAHCTQL
THLYLRRCVRLTDEGLRYLVIYCASIKELSVSDCRFVSDFGLREIAKLESRLRYLSIAHC
GRVTDVGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSLDIGKCPLVSDTGL
ECLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQTLNVQDCEVSVEALRFVKRHCKR
CVIEHTNPAFF

Sequence length

491

Interactions

View interactions

	Reactome
			FBXL7 down-regulates AURKA during mitotic entry and in early mitosis Neddylation Antigen processing: Ubiquitination & Proteasome degradation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (13)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIGEORGE SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMORRHOID	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (14)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Asthma	Associate	24486069, 31095684, 32119686	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Associate	20418484	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	37179372	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Associate	35887149	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioma capillary infantile	Associate	36181115	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Associate	22759382	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Associate	37179372	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ige Responsiveness Atopic	Associate	30584054	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Associate	23628382	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	37179372	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	22759382, 28472177, 37179372	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	35887149	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms Adipose Tissue	Associate	23628382	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	35887149	★★★★★ ★☆☆☆☆ Found in Text Mining only

FBXL7 (F-box and leucine rich repeat protein 7)