Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
23168
Gene name Gene Name - the full gene name approved by the HGNC.
RTF1 homolog, Paf1/RNA polymerase II complex component
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RTF1
Synonyms (NCBI Gene) Gene synonyms aliases
GTL7, KIAA0252
Chromosome Chromosome number
15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
15q15.1
Summary Summary of gene provided in NCBI Entrez Gene.
This locus may represent a gene involved in regulation of transcription elongation and chromatin remodeling, based on studies of similar proteins in other organisms. The encoded protein may bind single-stranded DNA. [provided by RefSeq, Sep 2010]
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT029127 hsa-miR-26b-5p Sequencing 20371350
MIRT042673 hsa-miR-196b-5p CLASH 23622248
MIRT614787 hsa-miR-4789-3p HITS-CLIP 23824327
MIRT614786 hsa-miR-4639-3p HITS-CLIP 23824327
MIRT614785 hsa-miR-6812-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II ISS
GO:0001711 Process Endodermal cell fate commitment IEA
GO:0001711 Process Endodermal cell fate commitment ISS
GO:0001832 Process Blastocyst growth IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
611633 28996 ENSG00000137815
Protein
UniProt ID Q92541
Protein name RNA polymerase-associated protein RTF1 homolog
Protein function Component of the PAF1 complex (PAF1C) which has multiple functions during transcription by RNA polymerase II and is implicated in regulation of development and maintenance of embryonic stem cell pluripotency. PAF1C associates with RNA polymerase
PDB 2BZE , 2DB9 , 3U1U , 4L1P , 4L1U , 6TED , 7UNC , 7UND , 8A3Y , 9EGX , 9EGY , 9EGZ , 9EH0 , 9EH1 , 9EH2
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03126 Plus-3 358 460 Plus-3 domain Domain
Sequence
MRGRLCVGRAAAAAAAVAVPLAGGQEGSPGGGRRGSRGTTMVKKRKGRVVIDSDTEDSGS
DENLDQELLSLAKRKRSDSEEKEPPVSQPAASSDSETSDSDDEWTFGSNKNKKKGKARKI
EKKGTMKKQANKTASSGSSDKDSSAESSAPEEGEVSDSDSNSSSSSSDSDSSSEDEEFHD
GYGEDLMGDEEDRARLEQMTEKEREQELFNRIEKREVLKRRFEIKKKLKTAKKKEKKEKK
KKQEEEQEKKKLTQIQESQVTSHNKERRSKRDEKLDKKSQAMEELKAEREKRKNRTAELL
AKKQPLKTSEVYSDDEEEEEDDKSSEKSDRSSRTSSSDEEEEKEEIPPKSQPVSLPEELN
RVRLSRHKLERWCHMPFFAKTVTGCFVRIGIGNHNSKPVYRVAEITGVVETAKVYQLGGT
RTNKGLQLRHGNDQRVFRLEFVSNQEFTESEFMKWKEAMF
SAGMQLPTLDEINKKELSIK
EALNYKFNDQDIEEIVKEKERFRKAPPNYAMKKTQLLKEKAMAEDLGDQDKAKQIQDQLN
ELEERAEALDRQRTKNISAISYINQRNREWNIVESEKALVAESHNMKNQQMDPFTRRQCK
PTIVSNSRDPAVQAAILAQLNAKYGSGVLPDAPKEMSKGQGKDKDLNSKSASDLSEDLFK
VHDFDVKIDLQVPSSESKALAITSKAPPAKDGAPRRSLNLEDYKKRRGLI
Sequence length 710
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Formation of RNA Pol II elongation complex
RNA Polymerase II Pre-transcription Events
RNA Polymerase II Transcription Elongation
E3 ubiquitin ligases ubiquitinate target proteins
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Asthma, Age of onset of childhood onset asthma, Atopic asthma N/A N/A GWAS
Coronary artery disease Coronary artery disease N/A N/A GWAS
Dermatitis Atopic dermatitis N/A N/A GWAS
Eczema Eczema N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Microsatellite Instability Associate 19888451
Neoplasms Associate 19888451