Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	22994
Gene name	Centrosomal protein 131
Gene symbol	CEP131
Synonyms (NCBI Gene)	AZ1AZI1ZA1
Chromosome	17
Chromosome location	17q25.3

Show/Hide all (42)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001669	Component	Acrosomal vesicle	IEA
GO:0002177	Component	Manchette	IEA
GO:0005515	Function	Protein binding	IPI	22797915, 24089205, 24407287, 24550735, 24816561, 26297806, 26638075, 27224062, 35271311
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	14654843
GO:0005813	Component	Centrosome	IDA	21399614, 22797915, 24550735, 27224062, 30538148, 30804208
GO:0005813	Component	Centrosome	IEA
GO:0005814	Component	Centriole	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005929	Component	Cilium	IDA
GO:0007283	Process	Spermatogenesis	IEA
GO:0007286	Process	Spermatid development	IEA
GO:0007288	Process	Sperm axoneme assembly	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	22797915
GO:0010824	Process	Regulation of centrosome duplication	IBA
GO:0010824	Process	Regulation of centrosome duplication	IMP	22797915
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0030030	Process	Cell projection organization	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0034451	Component	Centriolar satellite	IBA
GO:0034451	Component	Centriolar satellite	IDA	22797915, 24550735, 26297806, 30804208
GO:0034451	Component	Centriolar satellite	IEA
GO:0035735	Process	Intraciliary transport involved in cilium assembly	IEA
GO:0035735	Process	Intraciliary transport involved in cilium assembly	IMP	24550735
GO:0035869	Component	Ciliary transition zone	IDA	24415959
GO:0035869	Component	Ciliary transition zone	IEA
GO:0036064	Component	Ciliary basal body	IDA	27224062
GO:0042073	Process	Intraciliary transport	IEA
GO:0042803	Function	Protein homodimerization activity	IDA	24550735
GO:0042995	Component	Cell projection	IEA
GO:0044877	Function	Protein-containing complex binding	IDA	24550735
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045171	Component	Intercellular bridge	IDA
GO:0060271	Process	Cilium assembly	IBA
GO:0071539	Process	Protein localization to centrosome	IMP	26297806
GO:0090316	Process	Positive regulation of intracellular protein transport	IMP	24550735
GO:0120212	Component	Sperm head-tail coupling apparatus	IEA
GO:1905198	Process	Manchette assembly	IEA
GO:1905515	Process	Non-motile cilium assembly	IEA
GO:1990953	Process	Intramanchette transport	IEA

MIM	HGNC	e!Ensembl
613479	29511	ENSG00000141577

Q9UPN4

Protein name

Centrosomal protein of 131 kDa (5-azacytidine-induced protein 1) (Pre-acrosome localization protein 1)

Protein function

Component of centriolar satellites contributing to the building of a complex and dynamic network required to regulate cilia/flagellum formation (PubMed:17954613, PubMed:24185901). In proliferating cells, MIB1-mediated ubiquitination induces its

Family and domains

Sequence

MKGTRAIGSVPERSPAGVDLSLTGLPPPVSRRPGSAATTKPIVRSVSVVTGSEQKRKVLE
ATGPGGSQAINNLRRSNSTTQVSQPRSGSPRPTEPTDFLMLFEGSPSGKKRPASLSTAPS
EKGATWNVLDDQPRGFTLPSNARSSSALDSPAGPRRKECTVALAPNFTANNRSNKGAVGN
CVTTMVHNRYTPSERAPPLKSSNQTAPSLNNIIKAATCEGSESSGFGKLPKNVSSATHSA
RNNTGGSTGLPRRKEVTEEEAERFIHQVNQATVTIQRWYRHQVQRRGAGAARLEHLLQAK
REEQRQRSGEGTLLDLHQQKEAARRKAREEKARQARRAAIQELQQKRALRAQKASTAERG
PPENPRETRVPGMRQPAQELSPTPGGTAHQALKANNTGGGLPAAGPGDRCLPTSDSSPEP
QQPPEDRTQDVLAQDAAGDNLEMMAPSRGSAKSRGPLEELLHTLQLLEKEPDVLPRPRTH
HRGRYAWASEVTTEDDASSLTADNLEKFGKLSAFPEPPEDGTLLSEAKLQSIMSFLDEME
KSGQDQLDSQQEGWVPEAGPGPLELGSEVSTSVMRLKLEVEEKKQAMLLLQRALAQQRDL
TARRVKETEKALSRQLQRQREHYEATIQRHLAFIDQLIEDKKVLSEKCEAVVAELKQEDQ
RCTERVAQAQAQHELEIKKLKELMSATEKARREKWISEKTKKIKEVTVRGLEPEIQKLIA
RHKQEVRRLKSLHEAELLQSDERASQRCLRQAEELREQLEREKEALGQQERERARQRFQQ
HLEQEQWALQQQRQRLYSEVAEERERLGQQAARQRAELEELRQQLEESSSALTRALRAEF
EKGREEQERRHQMELNTLKQQLELERQAWEAGRTRKEEAWLLNREQELREEIRKGRDKEI
ELVIHRLEADMALAKEESEKAAESRIKRLRDKYEAELSELEQSERKLQERCSELKGQLGE
AEGENLRLQGLVRQKERALEDAQAVNEQLSSERSNLAQVIRQEFEDRLAASEEETRQAKA
ELATLQARQQLELEEVHRRVKTALARKEEAVSSLRTQHEAAVKRADHLEELLEQHRRPTP
STK

Sequence length

1083

Interactions

View interactions

	Reactome
			Regulation of PLK1 Activity at G2/M Transition Loss of Nlp from mitotic centrosomes Recruitment of mitotic centrosome proteins and complexes Loss of proteins required for interphase microtubule organization from the centrosome Recruitment of NuMA to mitotic centrosomes Anchoring of the basal body to the plasma membrane AURKA Activation by TPX2

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Gastric cancer	Uncertain significance	rs376926481	RCV005939114
Thymoma	Uncertain significance	rs376926481	RCV005939115

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Associate	28361952
Carcinoma Hepatocellular	Associate	36008383
Down Syndrome	Associate	35476505
Glioblastoma	Associate	36291099
Hereditary Breast and Ovarian Cancer Syndrome	Associate	28361952
Microcephaly	Associate	26297806
Neoplasms	Associate	31068247

CEP131 (centrosomal protein 131)