Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
22980
Gene name Gene Name - the full gene name approved by the HGNC.
TCF25 ribosome quality control complex subunit
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TCF25
Synonyms (NCBI Gene) Gene synonyms aliases
FKSG26, Hulp1, NULP1, PRO2620, hKIAA1049
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16q24.3
Summary Summary of gene provided in NCBI Entrez Gene.
TCF25 is a member of the basic helix-loop-helix (bHLH) family of transcription factors that are important in embryonic development (Steen and Lindholm, 2008 [PubMed 18068114]).[supplied by OMIM, Sep 2008]
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT050402 hsa-miR-23a-3p CLASH 23622248
MIRT046271 hsa-miR-23b-3p CLASH 23622248
MIRT037265 hsa-miR-877-5p CLASH 23622248
MIRT1416170 hsa-miR-3162-3p CLIP-seq
MIRT1416171 hsa-miR-4269 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 16189514, 19060904, 21516116, 24947832, 25416956, 28514442, 31046837, 31515488, 32296183, 32814053, 33961781, 35271311
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol IEA
GO:0061945 Process Regulation of protein K48-linked ubiquitination IDA 30244831
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
612326 29181 ENSG00000141002
Protein
UniProt ID Q9BQ70
Protein name Ribosome quality control complex subunit TCF25 (Nuclear localized protein 1) (Transcription factor 25) (TCF-25)
Protein function Component of the ribosome quality control complex (RQC), a ribosome-associated complex that mediates ubiquitination and extraction of incompletely synthesized nascent chains for proteasomal degradation (PubMed:30244831). In the RQC complex, requ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04910 Tcf25 248 588 Transcriptional repressor TCF25 Family
Tissue specificity TISSUE SPECIFICITY: In the embryo, widely expressed with highest levels in brain (PubMed:16574069). In the adult, highest expression is found in the heart (PubMed:16574069, PubMed:32805187). Repressed in cardiac tissue of patients with heart failure (at p
Sequence
MSRRALRRLRGEQRGQEPLGPGALHFDLRDDDDAEEEGPKRELGVRRPGGAGKEGVRVNN
RFELINIDDLEDDPVVNGERSGCALTDAVAPGNKGRGQRGNTESKTDGDDTETVPSEQSH
ASGKLRKKKKKQKNKKSSTGEASENGLEDIDRILERIEDSTGLNRPGPAPLSSRKHVLYV
EHRHLNPDTELKRYFGARAILGEQRPRQRQRVYPKCTWLTTPKSTWPRYSKPGLSMRLLE
SKKGLSFFAFEHSEEYQQAQHKFLVAVESMEPNNIVVLLQTSPYHVDSLLQLSDACRFQE
DQEMARDLVERALYSMECAFHPLFSLTSGACRLDYRRPENRSFYLALYKQMSFLEKRGCP
RTALEYCKLILSLEPDEDPLCMLLLIDHLALRARNYEYLIRLFQEWEAHRNLSQLPNFAF
SVPLAYFLLSQQTDLPECEQSSARQKASLLIQQALTMFPGVLLPLLESCSVRPDASVSSH
RFFGPNAEISQPPALSQLVNLYLGRSHFLWKEPATMSWLEENVHEVLQAVDAGDPAVEAC
ENRRKVLYQRAPRNIHRHVILSEIKEAVAALPPDVTTQSVMGFDPLPP
SDTIYSYVRPER
LSPISHGNTIALFFRSLLPNYTMEGERPEEGVAGGLNRNQGLNRLMLAVRDMMANFHLND
LEAPHEDDAEGEGEWD
Sequence length 676
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
Carcinoma Basal cell carcinoma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Arrhythmogenic Right Ventricular Dysplasia Associate 29221435