Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
22913
Gene name Gene Name - the full gene name approved by the HGNC.
RALY heterogeneous nuclear ribonucleoprotein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RALY
Synonyms (NCBI Gene) Gene synonyms aliases
HNRPCL2, P542
Chromosome Chromosome number
20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20q11.22
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the heterogeneous nuclear ribonucleoprotein (hnRNP) gene family. This protein may play a role in pre-mRNA splicing and in embryonic development. Alternate splicing results in multiple transcript variants. [provided by RefSeq,
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT044575 hsa-miR-320a CLASH 23622248
MIRT666746 hsa-miR-3614-3p HITS-CLIP 23824327
MIRT666747 hsa-miR-654-3p HITS-CLIP 23824327
MIRT666744 hsa-miR-3183 HITS-CLIP 23824327
MIRT666745 hsa-miR-4723-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II ISS
GO:0000398 Process MRNA splicing, via spliceosome IC 11991638
GO:0003676 Function Nucleic acid binding IEA
GO:0003712 Function Transcription coregulator activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
614663 15921 ENSG00000125970
Protein
UniProt ID Q9UKM9
Protein name RNA-binding protein Raly (Autoantigen p542) (Heterogeneous nuclear ribonucleoprotein C-like 2) (hnRNP core protein C-like 2) (hnRNP associated with lethal yellow protein homolog)
Protein function RNA-binding protein that acts as a transcriptional cofactor for cholesterol biosynthetic genes in the liver. Binds the lipid-responsive non-coding RNA LeXis and is required for LeXis-mediated effect on cholesterogenesis (By similarity). May be a
PDB 1WF1
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 23 86 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in heart, brain, lung, liver, skeletal muscle, kidney and pancreas. Weakly expressed in placenta. {ECO:0000269|PubMed:10500250}.
Sequence
MSLKLQASNVTNKNDPKSINSRVFIGNLNTALVKKSDVETIFSKYGRVAGCSVHKGYAFV
QYSNERHARAAVLGENGRVLAGQTLD
INMAGEPKPDRPKGLKRAASAIYSGYIFDYDYYR
DDFYDRLFDYRGRLSPVPVPRAVPVKRPRVTVPLVRRVKTNVPVKLFARSTAVTTSSAKI
KLKSSELQAIKTELTQIKSNIDALLSRLEQIAAEQKANPDGKKKGDGGGAGGGGGGGGSG
GGGSGGGGGGGSSRPPAPQENTTSEAGLPQGEARTRDDGDEEGLLTHSEEELEHSQDTDA
DDGALQ
Sequence length 306
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Actinic keratosis Actinic keratosis N/A N/A GWAS
Breast cancer Breast cancer N/A N/A GWAS
Carcinoma Squamous cell carcinoma, Basal cell carcinoma N/A N/A GWAS
Diabetes Type 2 diabetes N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Autoimmune Diseases Associate 7533789
Barrett Esophagus Associate 33491460
Carcinogenesis Stimulate 36952348
Colitis Ulcerative Associate 7533789
Colonic Neoplasms Associate 22118625
Colorectal Neoplasms Associate 22118625
Infectious Mononucleosis Associate 7533789
Inflammation Associate 35941292
Lung Neoplasms Stimulate 36952348
Lupus Erythematosus Systemic Associate 7533789