Gene Gene information from NCBI Gene database.
Entrez ID 22913
Gene name RALY heterogeneous nuclear ribonucleoprotein
Gene symbol RALY
Synonyms (NCBI Gene)
HNRPCL2P542
Chromosome 20
Chromosome location 20q11.22
Summary This gene encodes a member of the heterogeneous nuclear ribonucleoprotein (hnRNP) gene family. This protein may play a role in pre-mRNA splicing and in embryonic development. Alternate splicing results in multiple transcript variants. [provided by RefSeq,
miRNA miRNA information provided by mirtarbase database.
167
miRTarBase ID miRNA Experiments Reference
MIRT044575 hsa-miR-320a CLASH 23622248
MIRT666746 hsa-miR-3614-3p HITS-CLIP 23824327
MIRT666747 hsa-miR-654-3p HITS-CLIP 23824327
MIRT666744 hsa-miR-3183 HITS-CLIP 23824327
MIRT666745 hsa-miR-4723-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
22
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II ISS
GO:0000398 Process MRNA splicing, via spliceosome IC 11991638
GO:0003676 Function Nucleic acid binding IEA
GO:0003712 Function Transcription coregulator activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
614663 15921 ENSG00000125970
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UKM9
Protein name RNA-binding protein Raly (Autoantigen p542) (Heterogeneous nuclear ribonucleoprotein C-like 2) (hnRNP core protein C-like 2) (hnRNP associated with lethal yellow protein homolog)
Protein function RNA-binding protein that acts as a transcriptional cofactor for cholesterol biosynthetic genes in the liver. Binds the lipid-responsive non-coding RNA LeXis and is required for LeXis-mediated effect on cholesterogenesis (By similarity). May be a
PDB 1WF1
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 23 86 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in heart, brain, lung, liver, skeletal muscle, kidney and pancreas. Weakly expressed in placenta. {ECO:0000269|PubMed:10500250}.
Sequence
MSLKLQASNVTNKNDPKSINSRVFIGNLNTALVKKSDVETIFSKYGRVAGCSVHKGYAFV
QYSNERHARAAVLGENGRVLAGQTLD
INMAGEPKPDRPKGLKRAASAIYSGYIFDYDYYR
DDFYDRLFDYRGRLSPVPVPRAVPVKRPRVTVPLVRRVKTNVPVKLFARSTAVTTSSAKI
KLKSSELQAIKTELTQIKSNIDALLSRLEQIAAEQKANPDGKKKGDGGGAGGGGGGGGSG
GGGSGGGGGGGSSRPPAPQENTTSEAGLPQGEARTRDDGDEEGLLTHSEEELEHSQDTDA
DDGALQ
Sequence length 306
Interactions View interactions