Gene Gene information from NCBI Gene database.
Entrez ID 22822
Gene name Pleckstrin homology like domain family A member 1
Gene symbol PHLDA1
Synonyms (NCBI Gene)
DT1P1B11PHRIPTDAG51
Chromosome 12
Chromosome location 12q21.2
Summary This gene encodes an evolutionarily conserved proline-histidine rich nuclear protein. The encoded protein may play an important role in the anti-apoptotic effects of insulin-like growth factor-1. [provided by RefSeq, Jul 2008]
miRNA miRNA information provided by mirtarbase database.
695
miRTarBase ID miRNA Experiments Reference
MIRT019686 hsa-miR-375 Microarray 20215506
MIRT437651 hsa-miR-181a-5p MicroarrayqRT-PCR 22815788
MIRT737232 hsa-miR-3682-3p Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)qRT-PCRFlow cytometry 33033502
MIRT1231796 hsa-miR-101 CLIP-seq
MIRT1231797 hsa-miR-105 CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
2
Transcription factor Regulation Reference
EWSR1 Repression 22323082
FLI1 Repression 22323082
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 11369516, 16189514, 19060904
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
GO:0005730 Component Nucleolus IDA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605335 8933 ENSG00000139289
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8WV24
Protein name Pleckstrin homology-like domain family A member 1 (Apoptosis-associated nuclear protein) (Proline- and glutamine-rich protein) (PQ-rich protein) (PQR protein) (Proline- and histidine-rich protein) (T-cell death-associated gene 51 protein)
Protein function Seems to be involved in regulation of apoptosis. May be involved in detachment-mediated programmed cell death. May mediate apoptosis during neuronal development. May be involved in regulation of anti-apoptotic effects of IGF1. May be involved in
Family and domains
Tissue specificity TISSUE SPECIFICITY: Widely expressed with highest levels in pancreas. Strongly expressed by benign melanocytic nevi, and progressively reduced expressed in primary and metastatic melanomas (at protein level). {ECO:0000269|PubMed:12384558, ECO:0000269|PubM
Sequence
MRRAPAAERLLELGFPPRCGRQEPPFPLGVTRGWGRWPIQKRREGARPVPFSERSQEDGR
GPAARSSGTLWRIRTRLSLCRDPEPPPPLCLLRVSLLCALRAGGRGSRWGEDGARLLLLP
PARAAGNGEAEPSGGPSYAGRMLESSGCKALKEGVLEKRSDGLLQLWKKKCCILTEEGLL
LIPPKQLQHQQQQQQQQQQQQQQQPGQGPAEPSQPSGPAVASLEPPVKLKELHFSNMKTV
DCVERKGKYMYFTVVMAEGKEIDFRCPQDQGWNAEITLQMVQYKNRQAILAVKSTRQKQQ
HLVQQQPPSQPQPQPQLQPQPQPQPQPQPQPQSQPQPQPQPKPQPQQLHPYPHPHPHPHS
HPHSHPHPHPHPHPHQIPHPHPQPHSQPHGHRLLRSTSNSA
Sequence length 401
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Interaction between PHLDA1 and AURKA