Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
22822
Gene name Gene Name - the full gene name approved by the HGNC.
Pleckstrin homology like domain family A member 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PHLDA1
Synonyms (NCBI Gene) Gene synonyms aliases
DT1P1B11, PHRIP, TDAG51
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q21.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes an evolutionarily conserved proline-histidine rich nuclear protein. The encoded protein may play an important role in the anti-apoptotic effects of insulin-like growth factor-1. [provided by RefSeq, Jul 2008]
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT019686 hsa-miR-375 Microarray 20215506
MIRT437651 hsa-miR-181a-5p Microarray, qRT-PCR 22815788
MIRT737232 hsa-miR-3682-3p Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), qRT-PCR, Flow cytometry 33033502
MIRT1231796 hsa-miR-101 CLIP-seq
MIRT1231797 hsa-miR-105 CLIP-seq
Transcription factors
Transcription factor Regulation Reference
EWSR1 Repression 22323082
FLI1 Repression 22323082
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000086 Process G2/M transition of mitotic cell cycle TAS
GO:0005515 Function Protein binding IPI 11369516, 16189514, 19060904
GO:0005634 Component Nucleus IBA 21873635
GO:0005654 Component Nucleoplasm IDA
GO:0005730 Component Nucleolus IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605335 8933 ENSG00000139289
Protein
UniProt ID Q8WV24
Protein name Pleckstrin homology-like domain family A member 1 (Apoptosis-associated nuclear protein) (Proline- and glutamine-rich protein) (PQ-rich protein) (PQR protein) (Proline- and histidine-rich protein) (T-cell death-associated gene 51 protein)
Protein function Seems to be involved in regulation of apoptosis. May be involved in detachment-mediated programmed cell death. May mediate apoptosis during neuronal development. May be involved in regulation of anti-apoptotic effects of IGF1. May be involved in
Family and domains
Tissue specificity TISSUE SPECIFICITY: Widely expressed with highest levels in pancreas. Strongly expressed by benign melanocytic nevi, and progressively reduced expressed in primary and metastatic melanomas (at protein level). {ECO:0000269|PubMed:12384558, ECO:0000269|PubM
Sequence
MRRAPAAERLLELGFPPRCGRQEPPFPLGVTRGWGRWPIQKRREGARPVPFSERSQEDGR
GPAARSSGTLWRIRTRLSLCRDPEPPPPLCLLRVSLLCALRAGGRGSRWGEDGARLLLLP
PARAAGNGEAEPSGGPSYAGRMLESSGCKALKEGVLEKRSDGLLQLWKKKCCILTEEGLL
LIPPKQLQHQQQQQQQQQQQQQQQPGQGPAEPSQPSGPAVASLEPPVKLKELHFSNMKTV
DCVERKGKYMYFTVVMAEGKEIDFRCPQDQGWNAEITLQMVQYKNRQAILAVKSTRQKQQ
HLVQQQPPSQPQPQPQLQPQPQPQPQPQPQPQSQPQPQPQPKPQPQQLHPYPHPHPHPHS
HPHSHPHPHPHPHPHQIPHPHPQPHSQPHGHRLLRSTSNSA
Sequence length 401
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Interaction between PHLDA1 and AURKA
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Atrial fibrillation Atrial Fibrillation rs120074192, rs121908590, rs121908593, rs121434558, rs587776851, rs387906612, rs387906613, rs387906614, rs387906615, rs199472687, rs199472705, rs199473324, rs587777336, rs587777339, rs587777557
View all (6 more)
30061737
Dermatitis Dermatitis, Allergic Contact rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174 17374397
Unknown
Disease term Disease name Evidence References Source
Paroxysmal atrial fibrillation Paroxysmal atrial fibrillation 30061737 ClinVar
Associations from Text Mining
Disease Name Relationship Type References
Arthritis Juvenile Associate 39699225
Atrial Fibrillation Associate 33834070
Breast Neoplasms Inhibit 18597688, 18641796, 25238247
Breast Neoplasms Stimulate 24954507
Breast Neoplasms Associate 28640659, 29490281, 37047202
Carcinogenesis Associate 24954507
Carcinoma Hepatocellular Associate 37749575
Carcinoma Squamous Cell Associate 22427941
Cardiomyopathy Dilated Associate 33860048
Chronic Disease Associate 35218958