Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2258
Gene name Gene Name - the full gene name approved by the HGNC.
Fibroblast growth factor 13
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FGF13
Synonyms (NCBI Gene) Gene synonyms aliases
DEE90, FGF-13, FGF2, FHF-2, FHF2, LINC00889, XLID110
Chromosome Chromosome number
X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
Xq26.3-q27.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cel
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT732458 hsa-miR-193b-5p Immunohistochemistry (IHC), Luciferase reporter assay, Western blotting 32803505
MIRT995567 hsa-miR-541 CLIP-seq
MIRT995568 hsa-miR-578 CLIP-seq
MIRT995569 hsa-miR-654-5p CLIP-seq
MIRT995570 hsa-miR-1264 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000165 Process MAPK cascade IDA 12244047
GO:0001764 Process Neuron migration IEA
GO:0001764 Process Neuron migration ISS
GO:0005515 Function Protein binding IPI 15282281, 26392562, 32296183
GO:0005634 Component Nucleus IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
300070 3670 ENSG00000129682
Protein
UniProt ID Q92913
Protein name Fibroblast growth factor 13 (FGF-13) (Fibroblast growth factor homologous factor 2) (FHF-2)
Protein function Microtubule-binding protein which directly binds tubulin and is involved in both polymerization and stabilization of microtubules (By similarity). Through its action on microtubules, may participate in the refinement of axons by negatively regul
PDB 3HBW , 4DCK , 4JPZ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00167 FGF 69 195 Fibroblast growth factor Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed. Predominantly expressed in the nervous system. {ECO:0000269|PubMed:9232594}.
Sequence
MAAAIASSLIRQKRQAREREKSNACKCVSSPSKGKTSCDKNKLNVFSRVKLFGSKKRRRR
RPEPQLKGIVTKLYSRQGYHLQLQADGTIDGTKDEDSTYTLFNLIPVGLRVVAIQGVQTK
LYLAMNSEGYLYTSELFTPECKFKESVFENYYVTYSSMIYRQQQSGRGWYLGLNKEGEIM
KGNHVKKNKPAAHFL
PKPLKVAMYKEPSLHDLTEFSRSGSGTPTKSRSVSGVLNGGKSMS
HNEST
Sequence length 245
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Phase 0 - rapid depolarisation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Atrial Fibrillation Atrial fibrillation N/A N/A GWAS
Breast Cancer Breast cancer in BRCA2 mutation carriers N/A N/A GWAS
Developmental And Epileptic Encephalopathy developmental and epileptic encephalopathy, 90 N/A N/A GenCC
Epileptic encephalopathy undetermined early-onset epileptic encephalopathy N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Anodontia Associate 32249341
Carcinoma Hepatocellular Associate 32815653
Carcinoma Non Small Cell Lung Associate 33064958
Carcinoma Pancreatic Ductal Associate 34061869
CDKL5 deficiency disorder Associate 33245860
Colorectal Neoplasms Associate 33495804
Encephalitis Viral Associate 37891420
Epilepsy Associate 33245860
Epileptic Encephalopathy Early Infantile 3 Associate 33245860
Glioma Associate 33064958