Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2258
Gene name	Fibroblast growth factor 13
Gene symbol	FGF13
Synonyms (NCBI Gene)	DEE90FGF-13FGF2FHF-2FHF2LINC00889XLID110
Chromosome	X
Chromosome location	Xq26.3-q27.1
Summary	The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cel

109

Show/Hide all (109)

miRTarBase ID	miRNA	Experiments	Reference
MIRT732458	hsa-miR-193b-5p	Immunohistochemistry (IHC)Luciferase reporter assayWestern blotting	32803505
MIRT995567	hsa-miR-541	CLIP-seq
MIRT995568	hsa-miR-578	CLIP-seq
MIRT995569	hsa-miR-654-5p	CLIP-seq
MIRT995570	hsa-miR-1264	CLIP-seq
MIRT995571	hsa-miR-145	CLIP-seq
MIRT995572	hsa-miR-3180-5p	CLIP-seq
MIRT995573	hsa-miR-4712-5p	CLIP-seq
MIRT995574	hsa-miR-770-5p	CLIP-seq
MIRT995575	hsa-miR-2117	CLIP-seq
MIRT995576	hsa-miR-3170	CLIP-seq
MIRT995577	hsa-miR-4753-3p	CLIP-seq
MIRT995578	hsa-miR-563	CLIP-seq
MIRT2229344	hsa-miR-4330	CLIP-seq
MIRT2229345	hsa-miR-3689d	CLIP-seq
MIRT2532848	hsa-miR-4786-3p	CLIP-seq
MIRT2532849	hsa-miR-1185	CLIP-seq
MIRT2532850	hsa-miR-1224-5p	CLIP-seq
MIRT2532851	hsa-miR-1233	CLIP-seq
MIRT2532852	hsa-miR-1252	CLIP-seq
MIRT2532853	hsa-miR-1262	CLIP-seq
MIRT2532854	hsa-miR-128	CLIP-seq
MIRT2532855	hsa-miR-1288	CLIP-seq
MIRT2532856	hsa-miR-129-3p	CLIP-seq
MIRT2532857	hsa-miR-140-3p	CLIP-seq
MIRT2532858	hsa-miR-27a	CLIP-seq
MIRT2532859	hsa-miR-27b	CLIP-seq
MIRT2532860	hsa-miR-3065-3p	CLIP-seq
MIRT2532861	hsa-miR-3120-3p	CLIP-seq
MIRT2532862	hsa-miR-3143	CLIP-seq
MIRT2532863	hsa-miR-3169	CLIP-seq
MIRT2532864	hsa-miR-3545-3p	CLIP-seq
MIRT2532865	hsa-miR-3605-5p	CLIP-seq
MIRT2532866	hsa-miR-3617	CLIP-seq
MIRT2532867	hsa-miR-3679-5p	CLIP-seq
MIRT2229345	hsa-miR-3689d	CLIP-seq
MIRT2532868	hsa-miR-3692	CLIP-seq
MIRT2532869	hsa-miR-3915	CLIP-seq
MIRT2532870	hsa-miR-3941	CLIP-seq
MIRT2532871	hsa-miR-3973	CLIP-seq
MIRT2532872	hsa-miR-421	CLIP-seq
MIRT2532873	hsa-miR-4254	CLIP-seq
MIRT2532874	hsa-miR-4272	CLIP-seq
MIRT2532875	hsa-miR-4421	CLIP-seq
MIRT2532876	hsa-miR-4652-3p	CLIP-seq
MIRT2532877	hsa-miR-466	CLIP-seq
MIRT2532878	hsa-miR-4672	CLIP-seq
MIRT2532879	hsa-miR-4689	CLIP-seq
MIRT2532880	hsa-miR-4694-3p	CLIP-seq
MIRT2532881	hsa-miR-4701-3p	CLIP-seq
MIRT2532882	hsa-miR-4709-5p	CLIP-seq
MIRT2532883	hsa-miR-4719	CLIP-seq
MIRT2532884	hsa-miR-4731-3p	CLIP-seq
MIRT2532885	hsa-miR-4762-5p	CLIP-seq
MIRT2532848	hsa-miR-4786-3p	CLIP-seq
MIRT2532886	hsa-miR-4797-5p	CLIP-seq
MIRT2532887	hsa-miR-4801	CLIP-seq
MIRT2532888	hsa-miR-485-3p	CLIP-seq
MIRT2532889	hsa-miR-499-3p	CLIP-seq
MIRT2532890	hsa-miR-499a-3p	CLIP-seq
MIRT2532891	hsa-miR-511	CLIP-seq
MIRT2532892	hsa-miR-521	CLIP-seq
MIRT2532893	hsa-miR-539	CLIP-seq
MIRT2532894	hsa-miR-548k	CLIP-seq
MIRT2532895	hsa-miR-619	CLIP-seq
MIRT2532896	hsa-miR-641	CLIP-seq
MIRT2532874	hsa-miR-4272	CLIP-seq
MIRT2532848	hsa-miR-4786-3p	CLIP-seq
MIRT2532852	hsa-miR-1252	CLIP-seq
MIRT2532853	hsa-miR-1262	CLIP-seq
MIRT2532854	hsa-miR-128	CLIP-seq
MIRT2532855	hsa-miR-1288	CLIP-seq
MIRT2532857	hsa-miR-140-3p	CLIP-seq
MIRT2532858	hsa-miR-27a	CLIP-seq
MIRT2532859	hsa-miR-27b	CLIP-seq
MIRT2532860	hsa-miR-3065-3p	CLIP-seq
MIRT2532861	hsa-miR-3120-3p	CLIP-seq
MIRT2532862	hsa-miR-3143	CLIP-seq
MIRT2532863	hsa-miR-3169	CLIP-seq
MIRT2532864	hsa-miR-3545-3p	CLIP-seq
MIRT2532866	hsa-miR-3617	CLIP-seq
MIRT2229345	hsa-miR-3689d	CLIP-seq
MIRT2532868	hsa-miR-3692	CLIP-seq
MIRT2532870	hsa-miR-3941	CLIP-seq
MIRT2532871	hsa-miR-3973	CLIP-seq
MIRT2532872	hsa-miR-421	CLIP-seq
MIRT2532873	hsa-miR-4254	CLIP-seq
MIRT2532874	hsa-miR-4272	CLIP-seq
MIRT2532875	hsa-miR-4421	CLIP-seq
MIRT2532876	hsa-miR-4652-3p	CLIP-seq
MIRT2532877	hsa-miR-466	CLIP-seq
MIRT2532878	hsa-miR-4672	CLIP-seq
MIRT2532880	hsa-miR-4694-3p	CLIP-seq
MIRT2532881	hsa-miR-4701-3p	CLIP-seq
MIRT2532882	hsa-miR-4709-5p	CLIP-seq
MIRT2532883	hsa-miR-4719	CLIP-seq
MIRT2532884	hsa-miR-4731-3p	CLIP-seq
MIRT2532885	hsa-miR-4762-5p	CLIP-seq
MIRT2532848	hsa-miR-4786-3p	CLIP-seq
MIRT2532887	hsa-miR-4801	CLIP-seq
MIRT2532888	hsa-miR-485-3p	CLIP-seq
MIRT2532889	hsa-miR-499-3p	CLIP-seq
MIRT2532890	hsa-miR-499a-3p	CLIP-seq
MIRT2532891	hsa-miR-511	CLIP-seq
MIRT2532892	hsa-miR-521	CLIP-seq
MIRT2532893	hsa-miR-539	CLIP-seq
MIRT2532894	hsa-miR-548k	CLIP-seq
MIRT2532895	hsa-miR-619	CLIP-seq
MIRT2532896	hsa-miR-641	CLIP-seq

Show/Hide all (78)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IDA	12244047
GO:0001764	Process	Neuron migration	IEA
GO:0001764	Process	Neuron migration	ISS
GO:0005515	Function	Protein binding	IPI	15282281, 26392562, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	8790420
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS	21817159
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS	21817159
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005874	Component	Microtubule	IEA
GO:0005874	Component	Microtubule	ISS
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0006814	Process	Sodium ion transport	IEA
GO:0006814	Process	Sodium ion transport	ISS	21817159
GO:0007026	Process	Negative regulation of microtubule depolymerization	IEA
GO:0007026	Process	Negative regulation of microtubule depolymerization	ISS
GO:0007165	Process	Signal transduction	TAS	8790420
GO:0007267	Process	Cell-cell signaling	IEA
GO:0007267	Process	Cell-cell signaling	TAS	8790420
GO:0007399	Process	Nervous system development	IEA
GO:0007399	Process	Nervous system development	TAS	8790420
GO:0007611	Process	Learning or memory	IEA
GO:0007612	Process	Learning	IEA
GO:0007612	Process	Learning	ISS
GO:0007613	Process	Memory	IEA
GO:0007613	Process	Memory	ISS
GO:0008017	Function	Microtubule binding	IEA
GO:0008017	Function	Microtubule binding	ISS
GO:0008083	Function	Growth factor activity	IEA
GO:0008083	Function	Growth factor activity	TAS	8790420
GO:0014704	Component	Intercalated disc	IEA
GO:0014704	Component	Intercalated disc	ISS	21817159
GO:0016020	Component	Membrane	IEA
GO:0016328	Component	Lateral plasma membrane	IEA
GO:0016328	Component	Lateral plasma membrane	ISS	21817159
GO:0017080	Function	Sodium channel regulator activity	IBA
GO:0017080	Function	Sodium channel regulator activity	IDA	15282281, 36696443
GO:0017080	Function	Sodium channel regulator activity	IEA
GO:0017080	Function	Sodium channel regulator activity	ISS	21817159
GO:0021766	Process	Hippocampus development	IEA
GO:0021766	Process	Hippocampus development	ISS
GO:0021795	Process	Cerebral cortex cell migration	IEA
GO:0021795	Process	Cerebral cortex cell migration	ISS
GO:0022008	Process	Neurogenesis	IBA
GO:0022008	Process	Neurogenesis	IEA
GO:0030175	Component	Filopodium	IEA
GO:0030175	Component	Filopodium	ISS
GO:0030424	Component	Axon	IEA
GO:0030424	Component	Axon	ISS
GO:0030425	Component	Dendrite	IEA
GO:0030425	Component	Dendrite	ISS
GO:0030426	Component	Growth cone	IEA
GO:0030426	Component	Growth cone	ISS
GO:0042383	Component	Sarcolemma	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0043005	Component	Neuron projection	ISS
GO:0044325	Function	Transmembrane transporter binding	IEA
GO:0044325	Function	Transmembrane transporter binding	ISS	21817159
GO:0045200	Process	Establishment of neuroblast polarity	ISS
GO:0046785	Process	Microtubule polymerization	IEA
GO:0046785	Process	Microtubule polymerization	ISS
GO:0048487	Function	Beta-tubulin binding	IEA
GO:0048487	Function	Beta-tubulin binding	ISS
GO:0048671	Process	Negative regulation of collateral sprouting	ISS
GO:0048755	Process	Branching morphogenesis of a nerve	IEA
GO:0072659	Process	Protein localization to plasma membrane	IEA
GO:0072659	Process	Protein localization to plasma membrane	ISS	21817159
GO:0098909	Process	Regulation of cardiac muscle cell action potential involved in regulation of contraction	IEA
GO:0098909	Process	Regulation of cardiac muscle cell action potential involved in regulation of contraction	ISS	21817159
GO:1904862	Process	Inhibitory synapse assembly	IEA
GO:1904862	Process	Inhibitory synapse assembly	ISS
GO:1905152	Process	Positive regulation of voltage-gated sodium channel activity	IDA	36696443

MIM	HGNC	e!Ensembl
300070	3670	ENSG00000129682

Q92913

Protein name

Fibroblast growth factor 13 (FGF-13) (Fibroblast growth factor homologous factor 2) (FHF-2)

Protein function

Microtubule-binding protein which directly binds tubulin and is involved in both polymerization and stabilization of microtubules (By similarity). Through its action on microtubules, may participate in the refinement of axons by negatively regul

PDB

3HBW , 4DCK , 4JPZ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00167	FGF	69 → 195	Fibroblast growth factor	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed. Predominantly expressed in the nervous system. {ECO:0000269|PubMed:9232594}.

Sequence

MAAAIASSLIRQKRQAREREKSNACKCVSSPSKGKTSCDKNKLNVFSRVKLFGSKKRRRR
RPEPQLKGIVTKLYSRQGYHLQLQADGTIDGTKDEDSTYTLFNLIPVGLRVVAIQGVQTK
LYLAMNSEGYLYTSELFTPECKFKESVFENYYVTYSSMIYRQQQSGRGWYLGLNKEGEIM
KGNHVKKNKPAAHFLPKPLKVAMYKEPSLHDLTEFSRSGSGTPTKSRSVSGVLNGGKSMS
HNEST

Sequence length

245

Interactions

View interactions

	Reactome
			Phase 0 - rapid depolarisation

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Developmental and epileptic encephalopathy, 90	Likely pathogenic; Pathogenic	rs2124253547, rs2520980831, rs2520981115, rs2090039774, rs2090039606, rs2090039732	RCV001542464 RCV002287847 RCV002508182 RCV001292555 RCV001292556 RCV001292557

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
FGF13-related disorder	Uncertain significance; Conflicting classifications of pathogenicity; Likely benign	rs756270099, rs17510270, rs148880615	RCV004757579 RCV003901080 RCV003966751
Intellectual developmental disorder, X-linked 110	Conflicting classifications of pathogenicity	rs757803941	RCV003152463
Neurodevelopmental disorder	Uncertain significance	rs2090039732	RCV001374973
Thyroid cancer, nonmedullary, 1	Uncertain significance	rs2520980047	RCV005927668

Show/Hide Text Mining Associations (21)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Anodontia	Associate	32249341
Carcinoma Hepatocellular	Associate	32815653
Carcinoma Non Small Cell Lung	Associate	33064958
Carcinoma Pancreatic Ductal	Associate	34061869
CDKL5 deficiency disorder	Associate	33245860
Colorectal Neoplasms	Associate	33495804
Encephalitis Viral	Associate	37891420
Epilepsy	Associate	33245860
Epileptic Encephalopathy Early Infantile 3	Associate	33245860
Glioma	Associate	33064958
Lung Neoplasms	Associate	34533854
Mandibular Nerve Injuries	Associate	36222860
Melanoma	Associate	28852061, 33064958
Multiple Myeloma	Associate	33064958
Neoplasm Metastasis	Associate	19917848
Neoplasms	Associate	27994142, 33064958, 34533854
Neurologic Manifestations	Associate	36222860
Obsessive Compulsive Disorder	Associate	27527274
Pancreas Divisum	Inhibit	36222860
Prostatic Neoplasms	Associate	33064958
Uterine Cervical Neoplasms	Associate	24113164, 30283446, 33452347, 35782114

FGF13 (fibroblast growth factor 13)