Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2255
Gene name Gene Name - the full gene name approved by the HGNC.	Fibroblast growth factor 10
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	FGF10
Synonyms (NCBI Gene) Gene synonyms aliases	LADD3
Disease Acronyms (UniProt) Disease acronyms from UniProt database	LADD3
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5p12
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cel

Show/Hide all(8)

SNP ID	Visualize variation	Clinical significance	Consequence
rs104893884	G>A,C	Pathogenic	Coding sequence variant, missense variant, stop gained
rs104893886	A>C	Pathogenic	Coding sequence variant, missense variant
rs104893887	T>A	Pathogenic	Coding sequence variant, stop gained
rs104893889	C>T	Pathogenic	Coding sequence variant, missense variant
rs1554035469	C>T	Likely-pathogenic	Coding sequence variant, missense variant
rs1554035473	T>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1554035757	A>T	Likely-pathogenic	Coding sequence variant, missense variant
rs1554035763	C>-	Likely-pathogenic	Coding sequence variant, frameshift variant

Show/Hide all(156)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018544	hsa-miR-335-5p	Microarray	18185580
MIRT633902	hsa-miR-6748-3p	HITS-CLIP	23824327
MIRT633901	hsa-miR-4421	HITS-CLIP	23824327
MIRT633900	hsa-miR-5699-3p	HITS-CLIP	23824327
MIRT633899	hsa-miR-6841-3p	HITS-CLIP	23824327
MIRT668358	hsa-miR-1915-5p	HITS-CLIP	23824327
MIRT633898	hsa-miR-2115-5p	HITS-CLIP	23824327
MIRT633897	hsa-miR-516a-3p	HITS-CLIP	23824327
MIRT633896	hsa-miR-516b-3p	HITS-CLIP	23824327
MIRT633895	hsa-miR-7162-5p	HITS-CLIP	23824327
MIRT633894	hsa-miR-6830-3p	HITS-CLIP	23824327
MIRT633893	hsa-miR-502-5p	HITS-CLIP	23824327
MIRT668357	hsa-miR-3977	HITS-CLIP	23824327
MIRT633892	hsa-miR-511-5p	HITS-CLIP	23824327
MIRT633891	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT658151	hsa-miR-216b-5p	HITS-CLIP	23824327
MIRT628223	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT628222	hsa-miR-4705	HITS-CLIP	23824327
MIRT628221	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT623946	hsa-miR-7705	HITS-CLIP	23824327
MIRT638733	hsa-miR-6826-5p	HITS-CLIP	23824327
MIRT616822	hsa-miR-1283	HITS-CLIP	23824327
MIRT616821	hsa-miR-3671	HITS-CLIP	23824327
MIRT616820	hsa-miR-607	HITS-CLIP	23824327
MIRT616819	hsa-miR-1305	HITS-CLIP	23824327
MIRT616818	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT658151	hsa-miR-216b-5p	HITS-CLIP	23824327
MIRT628223	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT628221	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT616822	hsa-miR-1283	HITS-CLIP	23824327
MIRT616821	hsa-miR-3671	HITS-CLIP	23824327
MIRT616820	hsa-miR-607	HITS-CLIP	23824327
MIRT616819	hsa-miR-1305	HITS-CLIP	23824327
MIRT616818	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT616822	hsa-miR-1283	HITS-CLIP	23824327
MIRT616821	hsa-miR-3671	HITS-CLIP	23824327
MIRT616820	hsa-miR-607	HITS-CLIP	23824327
MIRT616819	hsa-miR-1305	HITS-CLIP	23824327
MIRT616818	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT623946	hsa-miR-7705	HITS-CLIP	23824327
MIRT638733	hsa-miR-6826-5p	HITS-CLIP	23824327
MIRT616822	hsa-miR-1283	HITS-CLIP	23824327
MIRT616821	hsa-miR-3671	HITS-CLIP	23824327
MIRT616820	hsa-miR-607	HITS-CLIP	23824327
MIRT616819	hsa-miR-1305	HITS-CLIP	23824327
MIRT616818	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT616822	hsa-miR-1283	HITS-CLIP	23824327
MIRT616821	hsa-miR-3671	HITS-CLIP	23824327
MIRT616820	hsa-miR-607	HITS-CLIP	23824327
MIRT616819	hsa-miR-1305	HITS-CLIP	23824327
MIRT616818	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT633902	hsa-miR-6748-3p	HITS-CLIP	23824327
MIRT633901	hsa-miR-4421	HITS-CLIP	23824327
MIRT633900	hsa-miR-5699-3p	HITS-CLIP	23824327
MIRT633899	hsa-miR-6841-3p	HITS-CLIP	23824327
MIRT633898	hsa-miR-2115-5p	HITS-CLIP	23824327
MIRT633897	hsa-miR-516a-3p	HITS-CLIP	23824327
MIRT633896	hsa-miR-516b-3p	HITS-CLIP	23824327
MIRT633895	hsa-miR-7162-5p	HITS-CLIP	23824327
MIRT633894	hsa-miR-6830-3p	HITS-CLIP	23824327
MIRT633893	hsa-miR-502-5p	HITS-CLIP	23824327
MIRT633892	hsa-miR-511-5p	HITS-CLIP	23824327
MIRT633891	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT616821	hsa-miR-3671	HITS-CLIP	23824327
MIRT616820	hsa-miR-607	HITS-CLIP	23824327
MIRT616819	hsa-miR-1305	HITS-CLIP	23824327
MIRT616818	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT628223	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT628222	hsa-miR-4705	HITS-CLIP	23824327
MIRT628221	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT623946	hsa-miR-7705	HITS-CLIP	23824327
MIRT616822	hsa-miR-1283	HITS-CLIP	23824327
MIRT616818	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT616822	hsa-miR-1283	HITS-CLIP	23824327
MIRT616821	hsa-miR-3671	HITS-CLIP	23824327
MIRT616820	hsa-miR-607	HITS-CLIP	23824327
MIRT616819	hsa-miR-1305	HITS-CLIP	23824327
MIRT616818	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT733529	hsa-miR-145-5p	Immunofluorescence, Immunohistochemistry (IHC), Luciferase reporter assay, qRT-PCR, Western blotting	31431501
MIRT633902	hsa-miR-6748-3p	HITS-CLIP	23824327
MIRT633901	hsa-miR-4421	HITS-CLIP	23824327
MIRT633900	hsa-miR-5699-3p	HITS-CLIP	23824327
MIRT633899	hsa-miR-6841-3p	HITS-CLIP	23824327
MIRT668358	hsa-miR-1915-5p	HITS-CLIP	23824327
MIRT633898	hsa-miR-2115-5p	HITS-CLIP	23824327
MIRT633897	hsa-miR-516a-3p	HITS-CLIP	23824327
MIRT633896	hsa-miR-516b-3p	HITS-CLIP	23824327
MIRT633895	hsa-miR-7162-5p	HITS-CLIP	23824327
MIRT633894	hsa-miR-6830-3p	HITS-CLIP	23824327
MIRT633893	hsa-miR-502-5p	HITS-CLIP	23824327
MIRT668357	hsa-miR-3977	HITS-CLIP	23824327
MIRT633892	hsa-miR-511-5p	HITS-CLIP	23824327
MIRT633891	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT658151	hsa-miR-216b-5p	HITS-CLIP	23824327
MIRT628223	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT628222	hsa-miR-4705	HITS-CLIP	23824327
MIRT628221	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT623946	hsa-miR-7705	HITS-CLIP	23824327
MIRT638733	hsa-miR-6826-5p	HITS-CLIP	23824327
MIRT616822	hsa-miR-1283	HITS-CLIP	23824327
MIRT616821	hsa-miR-3671	HITS-CLIP	23824327
MIRT616820	hsa-miR-607	HITS-CLIP	23824327
MIRT616819	hsa-miR-1305	HITS-CLIP	23824327
MIRT616818	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT658151	hsa-miR-216b-5p	HITS-CLIP	23824327
MIRT628223	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT628221	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT616822	hsa-miR-1283	HITS-CLIP	23824327
MIRT616821	hsa-miR-3671	HITS-CLIP	23824327
MIRT616820	hsa-miR-607	HITS-CLIP	23824327
MIRT616819	hsa-miR-1305	HITS-CLIP	23824327
MIRT616818	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT616822	hsa-miR-1283	HITS-CLIP	23824327
MIRT616821	hsa-miR-3671	HITS-CLIP	23824327
MIRT616820	hsa-miR-607	HITS-CLIP	23824327
MIRT616819	hsa-miR-1305	HITS-CLIP	23824327
MIRT616818	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT623946	hsa-miR-7705	HITS-CLIP	23824327
MIRT638733	hsa-miR-6826-5p	HITS-CLIP	23824327
MIRT616822	hsa-miR-1283	HITS-CLIP	23824327
MIRT616821	hsa-miR-3671	HITS-CLIP	23824327
MIRT616820	hsa-miR-607	HITS-CLIP	23824327
MIRT616819	hsa-miR-1305	HITS-CLIP	23824327
MIRT616818	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT616822	hsa-miR-1283	HITS-CLIP	23824327
MIRT616821	hsa-miR-3671	HITS-CLIP	23824327
MIRT616820	hsa-miR-607	HITS-CLIP	23824327
MIRT616819	hsa-miR-1305	HITS-CLIP	23824327
MIRT616818	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT633902	hsa-miR-6748-3p	HITS-CLIP	23824327
MIRT633901	hsa-miR-4421	HITS-CLIP	23824327
MIRT633900	hsa-miR-5699-3p	HITS-CLIP	23824327
MIRT633899	hsa-miR-6841-3p	HITS-CLIP	23824327
MIRT633898	hsa-miR-2115-5p	HITS-CLIP	23824327
MIRT633897	hsa-miR-516a-3p	HITS-CLIP	23824327
MIRT633896	hsa-miR-516b-3p	HITS-CLIP	23824327
MIRT633895	hsa-miR-7162-5p	HITS-CLIP	23824327
MIRT633894	hsa-miR-6830-3p	HITS-CLIP	23824327
MIRT633893	hsa-miR-502-5p	HITS-CLIP	23824327
MIRT633892	hsa-miR-511-5p	HITS-CLIP	23824327
MIRT633891	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT616821	hsa-miR-3671	HITS-CLIP	23824327
MIRT616820	hsa-miR-607	HITS-CLIP	23824327
MIRT616819	hsa-miR-1305	HITS-CLIP	23824327
MIRT616818	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT628223	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT628222	hsa-miR-4705	HITS-CLIP	23824327
MIRT628221	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT623946	hsa-miR-7705	HITS-CLIP	23824327
MIRT616822	hsa-miR-1283	HITS-CLIP	23824327
MIRT616818	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT616822	hsa-miR-1283	HITS-CLIP	23824327
MIRT616821	hsa-miR-3671	HITS-CLIP	23824327
MIRT616820	hsa-miR-607	HITS-CLIP	23824327
MIRT616819	hsa-miR-1305	HITS-CLIP	23824327
MIRT616818	hsa-miR-335-3p	HITS-CLIP	23824327

Transcription factors

Show/Hide all(3)

Transcription factor	Regulation	Reference
GATA4	Unknown	22303449
ISL1	Unknown	22303449
TBX20	Unknown	22303449

Show/Hide all(128)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000132	Process	Establishment of mitotic spindle orientation	IEA
GO:0000165	Process	MAPK cascade	TAS
GO:0000187	Process	Activation of MAPK activity	IDA	14975937
GO:0001525	Process	Angiogenesis	IEA
GO:0001656	Process	Metanephros development	IEP	18437684
GO:0001759	Process	Organ induction	IEA
GO:0001823	Process	Mesonephros development	IEP	18437684
GO:0001934	Process	Positive regulation of protein phosphorylation	IBA	21873635
GO:0001974	Process	Blood vessel remodeling	IEA
GO:0003338	Process	Metanephros morphogenesis	IEA
GO:0005104	Function	Fibroblast growth factor receptor binding	IBA	21873635
GO:0005104	Function	Fibroblast growth factor receptor binding	IDA	11923311
GO:0005111	Function	Type 2 fibroblast growth factor receptor binding	IBA	21873635
GO:0005111	Function	Type 2 fibroblast growth factor receptor binding	IPI	19224135
GO:0005515	Function	Protein binding	IPI	12591959, 25241761, 32296183
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IDA	16597614
GO:0005634	Component	Nucleus	IDA	11923311, 16597614, 17471512
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA	16597614
GO:0007368	Process	Determination of left/right symmetry	IEA
GO:0007431	Process	Salivary gland development	IMP	17213838
GO:0008083	Function	Growth factor activity	IBA	21873635
GO:0008083	Function	Growth factor activity	IDA	11923311, 15690149
GO:0008201	Function	Heparin binding	IDA	11923311
GO:0008284	Process	Positive regulation of cell population proliferation	IBA	21873635
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IBA	21873635
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	TAS
GO:0008589	Process	Regulation of smoothened signaling pathway	IEA
GO:0009880	Process	Embryonic pattern specification	IEA
GO:0009887	Process	Animal organ morphogenesis	IBA	21873635
GO:0009986	Component	Cell surface	IDA	16597614
GO:0009986	Component	Cell surface	NAS	11923311
GO:0010628	Process	Positive regulation of gene expression	IBA	21873635
GO:0010634	Process	Positive regulation of epithelial cell migration	IBA	21873635
GO:0010634	Process	Positive regulation of epithelial cell migration	IDA	17500053
GO:0010838	Process	Positive regulation of keratinocyte proliferation	IDA	17449030
GO:0021983	Process	Pituitary gland development	IEA
GO:0030154	Process	Cell differentiation	IBA	21873635
GO:0030334	Process	Regulation of cell migration	IBA	21873635
GO:0030538	Process	Embryonic genitalia morphogenesis	IEA
GO:0030878	Process	Thyroid gland development	IEA
GO:0030916	Process	Otic vesicle formation	IEA
GO:0030949	Process	Positive regulation of vascular endothelial growth factor receptor signaling pathway	IEA
GO:0031016	Process	Pancreas development	IEA
GO:0031069	Process	Hair follicle morphogenesis	IEA
GO:0031076	Process	Embryonic camera-type eye development	IEA
GO:0031532	Process	Actin cytoskeleton reorganization	IDA	17449030
GO:0032355	Process	Response to estradiol	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032781	Process	Positive regulation of ATPase activity	IDA	12804770
GO:0032808	Process	Lacrimal gland development	IMP	17213838
GO:0032925	Process	Regulation of activin receptor signaling pathway	IEA
GO:0034394	Process	Protein localization to cell surface	IDA	17449030
GO:0035019	Process	Somatic stem cell population maintenance	IEA
GO:0042056	Function	Chemoattractant activity	IBA	21873635
GO:0042056	Function	Chemoattractant activity	IDA	9740653, 17449030
GO:0042060	Process	Wound healing	IBA	21873635
GO:0042060	Process	Wound healing	IDA	11896977, 19152659
GO:0042246	Process	Tissue regeneration	IEA
GO:0042475	Process	Odontogenesis of dentin-containing tooth	IEA
GO:0042693	Process	Muscle cell fate commitment	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	12804770
GO:0045596	Process	Negative regulation of cell differentiation	IEA
GO:0045739	Process	Positive regulation of DNA repair	IDA	14975937
GO:0045747	Process	Positive regulation of Notch signaling pathway	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046579	Process	Positive regulation of Ras protein signal transduction	IDA	12804770
GO:0046877	Process	Regulation of saliva secretion	IMP	19102732
GO:0048146	Process	Positive regulation of fibroblast proliferation	IEA
GO:0048536	Process	Spleen development	IEA
GO:0048538	Process	Thymus development	IDA	17969154
GO:0048557	Process	Embryonic digestive tract morphogenesis	IEA
GO:0048754	Process	Branching morphogenesis of an epithelial tube	IDA	17959718
GO:0048807	Process	Female genitalia morphogenesis	IEA
GO:0048808	Process	Male genitalia morphogenesis	IEA
GO:0050671	Process	Positive regulation of lymphocyte proliferation	IDA	19152659
GO:0050673	Process	Epithelial cell proliferation	IDA	19224135
GO:0050674	Process	Urothelial cell proliferation	IDA	11923311
GO:0050677	Process	Positive regulation of urothelial cell proliferation	IDA	11923311
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IBA	21873635
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IDA	15690149
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IDA	17449030
GO:0050872	Process	White fat cell differentiation	IEA
GO:0050918	Process	Positive chemotaxis	IBA	21873635
GO:0050918	Process	Positive chemotaxis	IDA	9740653, 17449030
GO:0050930	Process	Induction of positive chemotaxis	IEA
GO:0051145	Process	Smooth muscle cell differentiation	IEA
GO:0051549	Process	Positive regulation of keratinocyte migration	IDA	17449030, 19152659
GO:0051897	Process	Positive regulation of protein kinase B signaling	TAS
GO:0060019	Process	Radial glial cell differentiation	ISS
GO:0060054	Process	Positive regulation of epithelial cell proliferation involved in wound healing	NAS	19152659
GO:0060173	Process	Limb development	IBA	21873635
GO:0060174	Process	Limb bud formation	IEA
GO:0060428	Process	Lung epithelium development	IDA	9740653
GO:0060430	Process	Lung saccule development	IMP	17071719
GO:0060436	Process	Bronchiole morphogenesis	IEA
GO:0060447	Process	Bud outgrowth involved in lung branching	IDA	9740653
GO:0060449	Process	Bud elongation involved in lung branching	IEA
GO:0060496	Process	Mesenchymal-epithelial cell signaling involved in lung development	IEA
GO:0060510	Process	Type II pneumocyte differentiation	IEA
GO:0060513	Process	Prostatic bud formation	IEA
GO:0060595	Process	Fibroblast growth factor receptor signaling pathway involved in mammary gland specification	IBA	21873635
GO:0060595	Process	Fibroblast growth factor receptor signaling pathway involved in mammary gland specification	IDA	11923311
GO:0060615	Process	Mammary gland bud formation	IEA
GO:0060661	Process	Submandibular salivary gland formation	IEA
GO:0060664	Process	Epithelial cell proliferation involved in salivary gland morphogenesis	IEA
GO:0060665	Process	Regulation of branching involved in salivary gland morphogenesis by mesenchymal-epithelial signaling	IEA
GO:0060667	Process	Branch elongation involved in salivary gland morphogenesis	IEA
GO:0060879	Process	Semicircular canal fusion	IEA
GO:0060915	Process	Mesenchymal cell differentiation involved in lung development	IEA
GO:0061033	Process	Secretion by lung epithelial cell involved in lung growth	IBA	21873635
GO:0061033	Process	Secretion by lung epithelial cell involved in lung growth	IDA	10541313
GO:0061115	Process	Lung proximal/distal axis specification	IEA
GO:0062023	Component	Collagen-containing extracellular matrix	IDA	17959718
GO:0070075	Process	Tear secretion	IMP	19102732
GO:0070352	Process	Positive regulation of white fat cell proliferation	IEA
GO:0070371	Process	ERK1 and ERK2 cascade	IDA	17959718
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IBA	21873635
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	14975937
GO:0070384	Process	Harderian gland development	IEA
GO:0071157	Process	Negative regulation of cell cycle arrest	IDA	17188682
GO:0071338	Process	Positive regulation of hair follicle cell proliferation	IDA	16086254
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IBA	21873635
GO:1900087	Process	Positive regulation of G1/S transition of mitotic cell cycle	IDA	17188682
GO:2001240	Process	Negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	IEA

MIM	HGNC	e!Ensembl
602115	3666	ENSG00000070193

Protein

UniProt ID

O15520

Protein name

Fibroblast growth factor 10 (FGF-10) (Keratinocyte growth factor 2)

Protein function

Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. May play a role in wound healing.

PDB

1NUN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00167	FGF	78 → 202	Fibroblast growth factor	Domain

Sequence

MWKWILTHCASAFPHLPGCCCCCFLLLFLVSSVPVTCQALGQDMVSPEATNSSSSSFSSP
SSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGV
VAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVAL
NGKGAPRRGQKTRRKNTSAHFLPMVVHS

Sequence length

208

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Ras signaling pathway Rap1 signaling pathway Calcium signaling pathway PI3K-Akt signaling pathway Regulation of actin cytoskeleton Pathways in cancer Chemical carcinogenesis - receptor activation Melanoma Breast cancer Gastric cancer		PI3K Cascade PIP3 activates AKT signaling FGFR1b ligand binding and activation FGFR2b ligand binding and activation Activated point mutants of FGFR2 Constitutive Signaling by Aberrant PI3K in Cancer Phospholipase C-mediated cascade: FGFR1 Phospholipase C-mediated cascade; FGFR2 Downstream signaling of activated FGFR1 SHC-mediated cascade:FGFR1 PI-3K cascade:FGFR1 FRS-mediated FGFR1 signaling PI-3K cascade:FGFR2 SHC-mediated cascade:FGFR2 FRS-mediated FGFR2 signaling Negative regulation of FGFR1 signaling Negative regulation of FGFR2 signaling Signaling by FGFR2 in disease FGFRL1 modulation of FGFR1 signaling RAF/MAP kinase cascade PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling

Show/Hide Causal Diseases (9)

Disease term	Disease name	dbSNP ID	References
Causal
Alzheimer disease	Alzheimer`s Disease	rs63750215, rs28936379, rs63749851, rs63749884, rs28936380, rs63750048, rs63750579, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039 View all (65 more)	26830138
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158 View all (309 more)	18438407
Breast carcinoma	Breast Carcinoma	rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451 View all (71 more)	29059683, 18438407
Hearing loss	Hearing Loss, Mixed Conductive-Sensorineural	rs267607135, rs267606855, rs779841884, rs267606854, rs28942097, rs121908073, rs121908076, rs74315289, rs121908144, rs111033313, rs74315437, rs121908348, rs121908349, rs121908350, rs397515359 View all (184 more)
Lacrimoauriculodentodigital syndrome	Lacrimoauriculodentodigital syndrome	rs104893885, rs104893886, rs104893887, rs1453271838	16630169, 16501574, 9988217
Marfan syndrome	Mammary Carcinoma, Human	rs137854456, rs137854457, rs267606796, rs137854458, rs137854459, rs137854460, rs137854470, rs137854471, rs267606797, rs137854461, rs137854462, rs137854463, rs869025419, rs137854464, rs137854465 View all (942 more)	18438407
Narcolepsy	Narcolepsy	rs104894574, rs387906655	19629137
Polydactyly	Polydactyly	rs1583729398, rs121917709, rs1583734240, rs121917714, rs397507422, rs398122899, rs587776959, rs386833752, rs1057518698, rs1060499558, rs755938967, rs1375768446, rs1309855392, rs1565601979, rs748321474 View all (3 more)
Prostate cancer	Malignant neoplasm of prostate, Prostate carcinoma	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	21743467, 29892016

Show/Hide Unknown Diseases (6)

Disease term	Disease name	Source
Unknown
Lacrimoauriculodentodigital Syndrome	lacrimoauriculodentodigital syndrome 3	GenCC
Congenital heart defects	congenital heart defects, multiple types	GenCC
Craniosynostosis	craniosynostosis	GenCC
Carcinoma	Carcinoma	GWAS
Acne	Acne	GWAS
Dental caries	Dental caries	GWAS

Show/Hide Text Mining Associations (53)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	35668376
Aplasia of Lacrimal and Salivary Glands	Associate	19102732
Arthritis Rheumatoid	Associate	39342401
Autism Spectrum Disorder	Associate	21996756
Brain Neoplasms	Associate	37423059
Breast Neoplasms	Associate	21767389, 22665522, 23527311, 27640304, 35668376
Bronchopulmonary Dysplasia	Associate	29722558
Carcinoma Acinar Cell	Associate	33967277
Cholangiocarcinoma	Associate	37369494
Cleft Lip	Associate	19137569, 22074045
Colonic Neoplasms	Associate	11598623
Colorectal Neoplasms	Associate	11598623
Conotruncal cardiac defects	Associate	32664970
Craniosynostoses	Associate	29215649
Cystic Adenomatoid Malformation of Lung Congenital	Associate	24004862
Cystitis Interstitial	Associate	16597614
Diabetes Mellitus Type 2	Associate	39342401
DiGeorge Syndrome	Associate	23121717
Endometriosis	Associate	17482184
Familial Primary Pulmonary Hypertension	Associate	29722558
Fibrosis	Associate	30155985
Gallbladder Neoplasms	Associate	24508317
Graves Ophthalmopathy	Inhibit	34383782
Hashimoto Disease	Associate	35720300
Hernias Diaphragmatic Congenital	Associate	26333573
Idiopathic Pulmonary Fibrosis	Inhibit	27869174
Idiopathic Pulmonary Fibrosis	Associate	29722558, 30155985
Inflammation	Associate	23328208, 34383782
Inflammation	Inhibit	31958320
Ischiopatellar dysplasia	Associate	35216193
Leukemia Myeloid Acute	Associate	36509141
Lung agenesis	Associate	30639323
Lung Diseases	Associate	29722558, 30639323
Lung Injury	Associate	30155985
Lung Injury	Inhibit	31958320
Lung Neoplasms	Associate	21569311, 36140747
Lymphatic Metastasis	Associate	26268776
Myopia	Associate	24265547, 38287803
Neoplasm Metastasis	Associate	26268776, 37369494
Neoplasms	Associate	21569311, 28029662, 35001007, 37280069
Oculocutaneous albinism type 2	Associate	24004862
Oculodentodigital Dysplasia	Associate	17682060, 28400699, 33967277
Orofacial Cleft 1	Associate	28232668
Pancreatic Neoplasms	Associate	18594526
Pleuropulmonary blastoma	Associate	24004862
Prostatic Hyperplasia	Associate	10503993
Prostatic Neoplasms	Associate	27787597
Pulmonary Disease Chronic Obstructive	Associate	29722558, 40192657
Pulmonary Disease Chronic Obstructive	Inhibit	33656381
Stomach Neoplasms	Associate	25743022, 26268776
Urethritis	Associate	16597614
Urinary Bladder Diseases	Associate	16597614
Urinary Bladder Neoplasms	Associate	23949743

FGF10 (fibroblast growth factor 10)