Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2253
Gene name Gene Name - the full gene name approved by the HGNC.
Fibroblast growth factor 8
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FGF8
Synonyms (NCBI Gene) Gene synonyms aliases
AIGF, FGF-8, HBGF-8, HH6, KAL6
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q24.32
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cel
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs137852659 G>T Pathogenic 5 prime UTR variant, missense variant, coding sequence variant
rs137852660 G>A Conflicting-interpretations-of-pathogenicity, pathogenic, uncertain-significance Missense variant, coding sequence variant, intron variant
rs137852661 A>G Pathogenic Missense variant, coding sequence variant, intron variant
rs137852662 T>C Pathogenic 5 prime UTR variant, missense variant, coding sequence variant
rs606231408 G>C Likely-pathogenic Coding sequence variant, synonymous variant, 5 prime UTR variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017212 hsa-miR-335-5p Microarray 18185580
MIRT054861 hsa-miR-503-5p Luciferase reporter assay, qRT-PCR, Western blot 24464787
MIRT995825 hsa-miR-2355-5p CLIP-seq
MIRT995826 hsa-miR-3065-3p CLIP-seq
MIRT995827 hsa-miR-361-3p CLIP-seq
Transcription factors
Transcription factor Regulation Reference
NFKB1 Activation 16683270
RELA Activation 16683270
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000165 Process MAPK cascade IEA
GO:0001569 Process Branching involved in blood vessel morphogenesis IEA
GO:0001656 Process Metanephros development IEP 18437684
GO:0001658 Process Branching involved in ureteric bud morphogenesis IEA
GO:0001759 Process Organ induction IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600483 3686 ENSG00000107831
Protein
UniProt ID P55075
Protein name Fibroblast growth factor 8 (FGF-8) (Androgen-induced growth factor) (AIGF) (Heparin-binding growth factor 8) (HBGF-8)
Protein function Plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. Required for normal brain, eye, ear and limb development during embryogenesis. Required for normal development of th
PDB 2FDB
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00167 FGF 70 193 Fibroblast growth factor Domain
Sequence
MGSPRSALSCLLLHLLVLCLQAQEGPGRGPALGRELASLFRAGREPQGVSQQHVREQSLV
TDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGA
ETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKG
SKTRQHQREVHFM
KRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR
Sequence length 233
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Chemical carcinogenesis - receptor activation
Melanoma
Breast cancer
Gastric cancer
  PI3K Cascade
PIP3 activates AKT signaling
Signaling by activated point mutants of FGFR1
Signaling by activated point mutants of FGFR3
FGFR4 ligand binding and activation
FGFR3b ligand binding and activation
FGFR3c ligand binding and activation
FGFR1c ligand binding and activation
FGFR2c ligand binding and activation
FGFR3 mutant receptor activation
Activated point mutants of FGFR2
Constitutive Signaling by Aberrant PI3K in Cancer
Phospholipase C-mediated cascade: FGFR1
Phospholipase C-mediated cascade; FGFR2
Phospholipase C-mediated cascade; FGFR3
Phospholipase C-mediated cascade; FGFR4
Downstream signaling of activated FGFR1
SHC-mediated cascade:FGFR1
PI-3K cascade:FGFR1
FRS-mediated FGFR1 signaling
PI-3K cascade:FGFR2
SHC-mediated cascade:FGFR2
FRS-mediated FGFR2 signaling
SHC-mediated cascade:FGFR3
FRS-mediated FGFR3 signaling
PI-3K cascade:FGFR3
FRS-mediated FGFR4 signaling
SHC-mediated cascade:FGFR4
PI-3K cascade:FGFR4
Negative regulation of FGFR1 signaling
Negative regulation of FGFR2 signaling
Negative regulation of FGFR3 signaling
Negative regulation of FGFR4 signaling
Signaling by FGFR2 in disease
Signaling by FGFR1 in disease
FGFRL1 modulation of FGFR1 signaling
RAF/MAP kinase cascade
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
Signaling by FGFR3 point mutants in cancer
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Holoprosencephaly Holoprosencephaly sequence rs876661329, rs1554834892, rs139565972, rs1554834889, rs876661331, rs1490604080, rs876661330 N/A
Hypogonadotropic Hypogonadism With Or Without Anosmia hypogonadotropic hypogonadism 6 with or without anosmia rs876661330, rs876661329, rs137852659, rs1554834303, rs137852661, rs137852662, rs137852663 N/A
Semilobar Holoprosencephaly semilobar holoprosencephaly rs876661329, rs876661328 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Hypogonadotropic Hypogonadism hypogonadotropic hypogonadism N/A N/A GenCC
Kallmann Syndrome Kallmann syndrome N/A N/A GenCC
Microcephaly microcephaly N/A N/A ClinVar
Peters Plus Syndrome peters plus syndrome N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Absent corpus callosum cataract immunodeficiency Associate 21832120
Adenocarcinoma Associate 31527546
Adrenal Insufficiency Associate 21832120
Amyotrophic Lateral Sclerosis Associate 29707616
Anodontia Associate 23533228
Bone Diseases Associate 23533228
Breast Neoplasms Associate 11953856
Carcinogenesis Associate 30079292
Carcinoma Ovarian Epithelial Associate 37762545
Cleft Lip Associate 29162626