Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2249
Gene name	Fibroblast growth factor 4
Gene symbol	FGF4
Synonyms (NCBI Gene)	FGF-4HBGF-4HSTHST-1HSTF-1HSTF1K-FGFKFGFSRTD22
Chromosome	11
Chromosome location	11q13.3
Summary	The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell

Show/Hide all (5)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018466	hsa-miR-335-5p	Microarray	18185580
MIRT1995276	hsa-miR-129-5p	CLIP-seq
MIRT1995277	hsa-miR-2052	CLIP-seq
MIRT1995278	hsa-miR-571	CLIP-seq
MIRT1995279	hsa-miR-759	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
NANOG	Activation	22378194
POU5F1	Activation	10801796
SOX2	Activation	10801796

Show/Hide all (45)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001502	Process	Cartilage condensation	IEA
GO:0005104	Function	Fibroblast growth factor receptor binding	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS	2959959
GO:0005615	Component	Extracellular space	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0006915	Process	Apoptotic process	IEA
GO:0007165	Process	Signal transduction	TAS	2959959
GO:0007267	Process	Cell-cell signaling	TAS	2959959
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IEA
GO:0008083	Function	Growth factor activity	TAS	2959959
GO:0008201	Function	Heparin binding	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IGI	8663044
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	2959959
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IBA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IEA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IGI	8663044
GO:0010463	Process	Mesenchymal cell proliferation	IDA	11023873
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0019827	Process	Stem cell population maintenance	IEA
GO:0022008	Process	Neurogenesis	IBA
GO:0030154	Process	Cell differentiation	IEA
GO:0030326	Process	Embryonic limb morphogenesis	IEA
GO:0030334	Process	Regulation of cell migration	IBA
GO:0035019	Process	Somatic stem cell population maintenance	IEA
GO:0035116	Process	Embryonic hindlimb morphogenesis	IEA
GO:0042475	Process	Odontogenesis of dentin-containing tooth	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0060363	Process	Cranial suture morphogenesis	IEA
GO:0060561	Process	Apoptotic process involved in morphogenesis	IEA
GO:0060591	Process	Chondroblast differentiation	IDA	17167778
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	17167778
GO:0072089	Process	Stem cell proliferation	IEA
GO:1904019	Process	Epithelial cell apoptotic process	IEA
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA
GO:2000544	Process	Regulation of endothelial cell chemotaxis to fibroblast growth factor	IDA	16756958
GO:2000648	Process	Positive regulation of stem cell proliferation	IEA

MIM	HGNC	e!Ensembl
164980	3682	ENSG00000075388

P08620

Protein name

Fibroblast growth factor 4 (FGF-4) (Heparin secretory-transforming protein 1) (HST) (HST-1) (HSTF-1) (Heparin-binding growth factor 4) (HBGF-4) (Transforming protein KS3)

Protein function

Plays an important role in the regulation of embryonic development, cell proliferation, and cell differentiation. Required for normal limb and cardiac valve development during embryogenesis. May play a role in embryonic molar tooth bud developme

PDB

1IJT

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00167	FGF	82 → 203	Fibroblast growth factor	Domain

Sequence

MSGPGTAAVALLPAVLLALLAPWAGRGGAAAPTAPNGTLEAELERRWESLVALSLARLPV
AAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSP
VERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIA
LSKNGKTKKGNRVSPTMKVTHFLPRL

Sequence length

206

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Ras signaling pathway Rap1 signaling pathway Calcium signaling pathway PI3K-Akt signaling pathway Regulation of actin cytoskeleton Pathways in cancer Chemical carcinogenesis - receptor activation Melanoma Breast cancer Gastric cancer		PI3K Cascade PIP3 activates AKT signaling Signaling by activated point mutants of FGFR1 Signaling by activated point mutants of FGFR3 FGFR4 ligand binding and activation FGFR3c ligand binding and activation FGFR1c ligand binding and activation FGFR2c ligand binding and activation FGFR3 mutant receptor activation Activated point mutants of FGFR2 Constitutive Signaling by Aberrant PI3K in Cancer Phospholipase C-mediated cascade: FGFR1 Phospholipase C-mediated cascade; FGFR2 Phospholipase C-mediated cascade; FGFR3 Phospholipase C-mediated cascade; FGFR4 Downstream signaling of activated FGFR1 SHC-mediated cascade:FGFR1 PI-3K cascade:FGFR1 FRS-mediated FGFR1 signaling PI-3K cascade:FGFR2 SHC-mediated cascade:FGFR2 FRS-mediated FGFR2 signaling SHC-mediated cascade:FGFR3 FRS-mediated FGFR3 signaling PI-3K cascade:FGFR3 FRS-mediated FGFR4 signaling SHC-mediated cascade:FGFR4 PI-3K cascade:FGFR4 Negative regulation of FGFR1 signaling Negative regulation of FGFR2 signaling Negative regulation of FGFR3 signaling Negative regulation of FGFR4 signaling Signaling by FGFR2 in disease Signaling by FGFR1 in disease FGFRL1 modulation of FGFR1 signaling RAF/MAP kinase cascade PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling Signaling by FGFR3 point mutants in cancer

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Thoracic dysostosis, isolated	Uncertain significance	rs2119827064	RCV005437952

Show/Hide Text Mining Associations (24)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Associate	12841847, 1989653, 24811890
Carcinogenesis	Associate	12841847
Carcinoma Squamous Cell	Associate	26943773
Cholangiocarcinoma	Associate	28445152
Colorectal Neoplasms	Associate	33779485
Coronary Artery Disease	Associate	34685725
Endometrial Neoplasms	Associate	16681770, 8685603
Esophageal Neoplasms	Associate	3133332, 3136110, 8509434
Esophageal Squamous Cell Carcinoma	Associate	18405350, 21734802, 29866946, 3136110, 33725708, 34962019
Gastrointestinal Stromal Tumors	Associate	30887595, 33199729
Hypoxia	Associate	34685725
Hypoxia Brain	Associate	34685725
Kidney Diseases	Associate	3133332
Lymphatic Metastasis	Associate	3133332
Myocardial Infarction	Associate	34685725
Neoplasm Metastasis	Associate	35614407
Neoplasms	Associate	10713114, 1409698, 24477574, 25822088, 3133332, 3136110
Neoplasms Germ Cell and Embryonal	Associate	2009969
Psychological Distress	Associate	34685725
Stomach Neoplasms	Associate	29866946, 34551773
Teratocarcinoma	Associate	2009969
Tertiary Lymphoid Structures	Associate	3136110
Urinary Bladder Neoplasms	Stimulate	3133332
Uterine Cervical Neoplasms	Associate	34951738

FGF4 (fibroblast growth factor 4)