FGB (fibrinogen beta chain)

Gene

• Entrez ID: 2244
• Gene name: Fibrinogen beta chain
• Gene symbol: FGB
• Synonyms (NCBI Gene): HEL-S-78p
• Chromosome: 4
• Chromosome location: 4q31.3
• Summary: The protein encoded by this gene is the beta component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abu

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs6054	C>T	Likely-benign, likely-pathogenic, pathogenic, uncertain-significance	Coding sequence variant, missense variant
rs121909616	C>T	Other, likely-pathogenic	Missense variant, coding sequence variant
rs121909621	T>G	Pathogenic	Missense variant, coding sequence variant
rs121909622	G>A	Pathogenic	Missense variant, coding sequence variant
rs121909624	T>A,C	Pathogenic	Missense variant, coding sequence variant
rs121909625	C>T	Pathogenic, likely-pathogenic	Stop gained, coding sequence variant
rs606231223	C>T	Pathogenic	Intron variant
rs606231224	G>T	Pathogenic	Splice donor variant
rs1578783532	T>C	Pathogenic	Coding sequence variant, missense variant
rs1578785111	G>C	Pathogenic	Coding sequence variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005517	hsa-miR-409-3p	ELISA, Flow, Luciferase reporter assay	20570858
MIRT005526	hsa-miR-29c-3p	Luciferase reporter assay	20570858
MIRT005530	hsa-miR-144-3p	Luciferase reporter assay	20570858
MIRT005532	hsa-miR-29a-3p	Luciferase reporter assay	20570858
MIRT005534	hsa-miR-29b-3p	Luciferase reporter assay	20570858
MIRT005526	hsa-miR-29c-3p	Luciferase reporter assay	20570858
MIRT518174	hsa-miR-6890-5p	PAR-CLIP	23446348
MIRT518173	hsa-miR-3155a	PAR-CLIP	23446348
MIRT518172	hsa-miR-3155b	PAR-CLIP	23446348
MIRT518171	hsa-miR-484	PAR-CLIP	23446348
MIRT518170	hsa-miR-1279	PAR-CLIP	23446348
MIRT518169	hsa-miR-193b-5p	PAR-CLIP	23446348
MIRT518168	hsa-miR-6801-5p	PAR-CLIP	23446348
MIRT518167	hsa-miR-6832-5p	PAR-CLIP	23446348
MIRT518166	hsa-miR-197-3p	PAR-CLIP	23446348
MIRT518165	hsa-miR-3170	PAR-CLIP	23446348
MIRT518164	hsa-miR-6855-5p	PAR-CLIP	23446348
MIRT518163	hsa-miR-5587-5p	PAR-CLIP	23446348
MIRT518162	hsa-miR-5096	PAR-CLIP	23446348
MIRT518174	hsa-miR-6890-5p	PAR-CLIP	23446348
MIRT518173	hsa-miR-3155a	PAR-CLIP	23446348
MIRT518172	hsa-miR-3155b	PAR-CLIP	23446348
MIRT518171	hsa-miR-484	PAR-CLIP	23446348
MIRT518170	hsa-miR-1279	PAR-CLIP	23446348
MIRT518169	hsa-miR-193b-5p	PAR-CLIP	23446348
MIRT518168	hsa-miR-6801-5p	PAR-CLIP	23446348
MIRT518167	hsa-miR-6832-5p	PAR-CLIP	23446348
MIRT518166	hsa-miR-197-3p	PAR-CLIP	23446348
MIRT518165	hsa-miR-3170	PAR-CLIP	23446348
MIRT518164	hsa-miR-6855-5p	PAR-CLIP	23446348
MIRT518163	hsa-miR-5587-5p	PAR-CLIP	23446348
MIRT518162	hsa-miR-5096	PAR-CLIP	23446348
MIRT995121	hsa-miR-122	CLIP-seq
MIRT995122	hsa-miR-1273f	CLIP-seq
MIRT995123	hsa-miR-1289	CLIP-seq
MIRT995124	hsa-miR-129-5p	CLIP-seq
MIRT995125	hsa-miR-1304	CLIP-seq
MIRT995126	hsa-miR-197	CLIP-seq
MIRT995127	hsa-miR-3135b	CLIP-seq
MIRT995128	hsa-miR-3155	CLIP-seq
MIRT995129	hsa-miR-3198	CLIP-seq
MIRT995130	hsa-miR-3199	CLIP-seq
MIRT995131	hsa-miR-3652	CLIP-seq
MIRT995132	hsa-miR-4269	CLIP-seq
MIRT995133	hsa-miR-4294	CLIP-seq
MIRT995134	hsa-miR-4309	CLIP-seq
MIRT995135	hsa-miR-4423-5p	CLIP-seq
MIRT995136	hsa-miR-4430	CLIP-seq
MIRT995137	hsa-miR-4438	CLIP-seq
MIRT995138	hsa-miR-4715-3p	CLIP-seq
MIRT995139	hsa-miR-4722-3p	CLIP-seq
MIRT995140	hsa-miR-4794	CLIP-seq
MIRT995141	hsa-miR-5095	CLIP-seq
MIRT995142	hsa-miR-1267	CLIP-seq
MIRT995143	hsa-miR-150	CLIP-seq
MIRT995126	hsa-miR-197	CLIP-seq
MIRT995144	hsa-miR-203	CLIP-seq
MIRT995145	hsa-miR-3147	CLIP-seq
MIRT995128	hsa-miR-3155	CLIP-seq
MIRT995146	hsa-miR-320a	CLIP-seq
MIRT995147	hsa-miR-320b	CLIP-seq
MIRT995148	hsa-miR-320c	CLIP-seq
MIRT995149	hsa-miR-320d	CLIP-seq
MIRT995150	hsa-miR-3545-3p	CLIP-seq
MIRT995151	hsa-miR-3619-3p	CLIP-seq
MIRT995152	hsa-miR-3654	CLIP-seq
MIRT995153	hsa-miR-3663-5p	CLIP-seq
MIRT995154	hsa-miR-4252	CLIP-seq
MIRT995155	hsa-miR-4425	CLIP-seq
MIRT995156	hsa-miR-4429	CLIP-seq
MIRT995157	hsa-miR-450b-3p	CLIP-seq
MIRT995158	hsa-miR-4635	CLIP-seq
MIRT995159	hsa-miR-4680-5p	CLIP-seq
MIRT995160	hsa-miR-4707-3p	CLIP-seq
MIRT995161	hsa-miR-4742-3p	CLIP-seq
MIRT995162	hsa-miR-4776-5p	CLIP-seq
MIRT995163	hsa-miR-520g	CLIP-seq
MIRT995164	hsa-miR-520h	CLIP-seq
MIRT995165	hsa-miR-653	CLIP-seq
MIRT995166	hsa-miR-769-3p	CLIP-seq
MIRT995122	hsa-miR-1273f	CLIP-seq
MIRT995126	hsa-miR-197	CLIP-seq
MIRT995128	hsa-miR-3155	CLIP-seq
MIRT995150	hsa-miR-3545-3p	CLIP-seq
MIRT995153	hsa-miR-3663-5p	CLIP-seq
MIRT995158	hsa-miR-4635	CLIP-seq
MIRT995159	hsa-miR-4680-5p	CLIP-seq
MIRT995123	hsa-miR-1289	CLIP-seq
MIRT995124	hsa-miR-129-5p	CLIP-seq
MIRT1995077	hsa-miR-1302	CLIP-seq
MIRT995125	hsa-miR-1304	CLIP-seq
MIRT1995078	hsa-miR-1825	CLIP-seq
MIRT1995079	hsa-miR-199a-5p	CLIP-seq
MIRT1995080	hsa-miR-199b-5p	CLIP-seq
MIRT995129	hsa-miR-3198	CLIP-seq
MIRT995130	hsa-miR-3199	CLIP-seq
MIRT1995081	hsa-miR-3925-3p	CLIP-seq
MIRT995132	hsa-miR-4269	CLIP-seq
MIRT995133	hsa-miR-4294	CLIP-seq
MIRT1995082	hsa-miR-4298	CLIP-seq
MIRT995134	hsa-miR-4309	CLIP-seq
MIRT1995083	hsa-miR-432	CLIP-seq
MIRT995137	hsa-miR-4438	CLIP-seq
MIRT1995084	hsa-miR-4648	CLIP-seq
MIRT995138	hsa-miR-4715-3p	CLIP-seq
MIRT995139	hsa-miR-4722-3p	CLIP-seq
MIRT1995085	hsa-miR-4735-5p	CLIP-seq
MIRT1995086	hsa-miR-4775	CLIP-seq
MIRT995140	hsa-miR-4794	CLIP-seq
MIRT995141	hsa-miR-5095	CLIP-seq
MIRT1995087	hsa-miR-590-3p	CLIP-seq
MIRT995122	hsa-miR-1273f	CLIP-seq
MIRT2449652	hsa-miR-3149	CLIP-seq
MIRT2449653	hsa-miR-411	CLIP-seq
MIRT2449654	hsa-miR-4328	CLIP-seq
MIRT995138	hsa-miR-4715-3p	CLIP-seq
MIRT995139	hsa-miR-4722-3p	CLIP-seq
MIRT1995085	hsa-miR-4735-5p	CLIP-seq
MIRT1995086	hsa-miR-4775	CLIP-seq
MIRT995140	hsa-miR-4794	CLIP-seq
MIRT1995087	hsa-miR-590-3p	CLIP-seq
MIRT995122	hsa-miR-1273f	CLIP-seq
MIRT995126	hsa-miR-197	CLIP-seq
MIRT2449652	hsa-miR-3149	CLIP-seq
MIRT2449653	hsa-miR-411	CLIP-seq
MIRT995138	hsa-miR-4715-3p	CLIP-seq
MIRT995139	hsa-miR-4722-3p	CLIP-seq
MIRT1995085	hsa-miR-4735-5p	CLIP-seq
MIRT1995086	hsa-miR-4775	CLIP-seq
MIRT995140	hsa-miR-4794	CLIP-seq
MIRT1995087	hsa-miR-590-3p	CLIP-seq
MIRT995122	hsa-miR-1273f	CLIP-seq
MIRT995126	hsa-miR-197	CLIP-seq
MIRT2449652	hsa-miR-3149	CLIP-seq
MIRT995130	hsa-miR-3199	CLIP-seq
MIRT2449653	hsa-miR-411	CLIP-seq
MIRT995132	hsa-miR-4269	CLIP-seq
MIRT995137	hsa-miR-4438	CLIP-seq
MIRT995138	hsa-miR-4715-3p	CLIP-seq
MIRT995139	hsa-miR-4722-3p	CLIP-seq
MIRT1995085	hsa-miR-4735-5p	CLIP-seq
MIRT1995086	hsa-miR-4775	CLIP-seq
MIRT995140	hsa-miR-4794	CLIP-seq
MIRT995141	hsa-miR-5095	CLIP-seq
MIRT1995087	hsa-miR-590-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
FOXM1	Repression	15737987

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0005102	Function	Signaling receptor binding	IDA	10903502
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005198	Function	Structural molecule activity	IDA	8910396
GO:0005201	Function	Extracellular matrix structural constituent	HDA	28344315
GO:0005201	Function	Extracellular matrix structural constituent	RCA	25037231, 28327460, 28675934
GO:0005515	Function	Protein binding	IPI	12706644, 20162731
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005576	Component	Extracellular region	TAS
GO:0005577	Component	Fibrinogen complex	IDA	6688356, 8910396, 16846481, 18676163
GO:0005577	Component	Fibrinogen complex	IEA
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	6777381, 19996109
GO:0005615	Component	Extracellular space	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005886	Component	Plasma membrane	TAS
GO:0005938	Component	Cell cortex	IEA
GO:0007160	Process	Cell-matrix adhesion	IBA
GO:0007160	Process	Cell-matrix adhesion	IDA	10903502
GO:0007596	Process	Blood coagulation	IEA
GO:0007599	Process	Hemostasis	IEA
GO:0009897	Component	External side of plasma membrane	IDA	6777381
GO:0009986	Component	Cell surface	IDA	6777381
GO:0030168	Process	Platelet activation	IEA
GO:0031012	Component	Extracellular matrix	HDA	25037231, 28327460, 28344315, 28675934
GO:0031012	Component	Extracellular matrix	IBA
GO:0031091	Component	Platelet alpha granule	IDA	6777381
GO:0031093	Component	Platelet alpha granule lumen	TAS
GO:0031639	Process	Plasminogen activation	IDA	16846481
GO:0034116	Process	Positive regulation of heterotypic cell-cell adhesion	IDA	8100742
GO:0042730	Process	Fibrinolysis	IDA	16846481
GO:0043152	Process	Induction of bacterial agglutination	IDA	24367264
GO:0044320	Process	Cellular response to leptin stimulus	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045202	Component	Synapse	IEA
GO:0045907	Process	Positive regulation of vasoconstriction	IDA	15739255
GO:0045921	Process	Positive regulation of exocytosis	IDA	19193866
GO:0050714	Process	Positive regulation of protein secretion	IDA	19193866
GO:0050839	Function	Cell adhesion molecule binding	IDA	9182580
GO:0051087	Function	Protein-folding chaperone binding	IPI	19996109
GO:0051258	Process	Protein polymerization	IDA	12706644
GO:0051258	Process	Protein polymerization	IEA
GO:0051592	Process	Response to calcium ion	IDA	6777381
GO:0065003	Process	Protein-containing complex assembly	IDA	8910396
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	10903502, 19193866
GO:0070527	Process	Platelet aggregation	IBA
GO:0070527	Process	Platelet aggregation	IDA	6281794
GO:0071347	Process	Cellular response to interleukin-1	IEA
GO:0072378	Process	Blood coagulation, fibrin clot formation	IBA
GO:0072378	Process	Blood coagulation, fibrin clot formation	IDA	16846481
GO:0072562	Component	Blood microparticle	HDA	22516433
GO:0072562	Component	Blood microparticle	IEA
GO:0090277	Process	Positive regulation of peptide hormone secretion	IDA	19193866
GO:1900026	Process	Positive regulation of substrate adhesion-dependent cell spreading	NAS	24041635
GO:1902042	Process	Negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IDA	10903502
GO:1903561	Component	Extracellular vesicle	HDA	24769233
GO:2000352	Process	Negative regulation of endothelial cell apoptotic process	IDA	10903502

Other IDs

• MIM: 134830
• HGNC: 3662
• e!Ensembl: ENSG00000171564

Protein

• UniProt ID: P02675
• Protein name: Fibrinogen beta chain [Cleaved into: Fibrinopeptide B; Fibrinogen beta chain]
• Protein function: Cleaved by the protease thrombin to yield monomers which, together with fibrinogen alpha (FGA) and fibrinogen gamma (FGG), polymerize to form an insoluble fibrin matrix. Fibrin has a major function in hemostasis as one of the primary components
• PDB: 1FZA, 1FZB, 1FZC, 1FZE, 1FZF, 1FZG, 1LT9, 1LTJ, 1N86, 1N8E, 1RE3, 1RE4, 1RF0, 1RF1, 2A45, 2FFD, 2H43, 2HLO, 2HOD, 2HPC, 2OYH, 2OYI, 2Q9I, 2XNX, 2XNY, 2Z4E, 3BVH, 3E1I, 3GHG, 3H32, 3HUS, 6ATZ, 6BIJ, 6BIL, 6V0Y, 6V13, 6V15, 6V18, 6V19, 6V1A
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF08702	Fib_alpha	91 → 234	Fibrinogen alpha/beta chain family	Coiled-coil
  PF00147	Fibrinogen_C	237 → 487	Fibrinogen beta and gamma chains, C-terminal globular domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in blood plasma (at protein level). {ECO:0000269|PubMed:10074346, ECO:0000269|PubMed:19296670, ECO:0000269|PubMed:9628725}.
• Sequence:

  MKRMVSWSFHKLKTMKHLLLLLLCVFLVKSQGVNDNEEGFFSARGHRPLDKKREEAPSLR
  PAPPPISGGGYRARPAKAAATQKKVERKAPDAGGCLHADPDLGVLCPTGCQLQEALLQQE
  RPIRNSVDELNNNVEAVSQTSSSSFQYMYLLKDLWQKRQKQVKDNENVVNEYSSELEKHQ
  LYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKE
  CEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYK
  QGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFT
  VQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDP
  RKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKM
  SMKIRPFFPQQ

• Sequence length: 491

Pathways

KEGG:

Complement and coagulation cascades
Platelet activation
Neutrophil extracellular trap formation
Coronavirus disease - COVID-19

Reactome:

Platelet degranulation
Common Pathway of Fibrin Clot Formation
Integrin cell surface interactions
Integrin signaling
GRB2:SOS provides linkage to MAPK signaling for Integrins
p130Cas linkage to MAPK signaling for integrins
MAP2K and MAPK activation
Regulation of TLR by endogenous ligand
Signaling by moderate kinase activity BRAF mutants
Signaling by high-kinase activity BRAF mutants
Signaling by BRAF and RAF fusions
Paradoxical activation of RAF signaling by kinase inactive BRAF
Signaling downstream of RAS mutants

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Afibrinogenemia	Likely pathogenic; Pathogenic	rs121909625	RCV002243650	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Congenital afibrinogenemia	Pathogenic; Likely pathogenic	rs121909621, rs121909622, rs606231223, rs606231224, rs121909624, rs121909625, rs1578785111	RCV000017815 RCV000017816 RCV000017818 RCV000017819 RCV000017821 RCV000017822 RCV000984797	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Familial dysfibrinogenemia	Likely pathogenic; Pathogenic	rs2530775972, rs1578783532, rs111502670	RCV003493346 RCV000984798 RCV001260487	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
FGB-related disorder	Likely pathogenic	rs2530775972, rs2530766247	RCV004747302 RCV003898936	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
FIBRINOGEN CHRISTCHURCH 2	Likely pathogenic	rs121909616	RCV000017804	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hypofibrinogenemia	Likely pathogenic; Pathogenic	rs121909616, rs121909625	RCV000852015 RCV000851927	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Abnormal bleeding	Conflicting classifications of pathogenicity; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CAROTID ARTERY DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Deep venous thrombosis	Conflicting classifications of pathogenicity; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSFIBRINOGENEMIA, CONGENITAL	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL AFIBRINOGENEMIA	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL HYPODYSFIBRINOGENEMIA	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL HYPOFIBRINOGENEMIA	—	CTD, Disgenet, Orphanet CTD, Disgenet, Orphanet CTD, Disgenet, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FIBRINOGEN BALTIMORE 2	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FIBRINOGEN ISE	other	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FIBRINOGEN LONGMONT	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FIBRINOGEN NAPLES	other	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FIBRINOGEN NIJMEGEN	other	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FIBRINOGEN PONTOISE 2	other	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FIBRINOGEN, BETA-148 POLYMORPHISM	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FIBRINOGEN-BETA POLYMORPHISM	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOPOROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombocytopenia	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombus	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
AA amyloidosis	Associate	16221199, 37353960	★☆☆☆☆ Found in Text Mining only
Abortion Habitual	Associate	18759277	★☆☆☆☆ Found in Text Mining only
Abortion Spontaneous	Associate	19229055, 9332319	★☆☆☆☆ Found in Text Mining only
Abruptio Placentae	Associate	13960907	★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Associate	24203353	★☆☆☆☆ Found in Text Mining only
Acute Disease	Stimulate	24335474	★☆☆☆☆ Found in Text Mining only
Acute Kidney Injury	Associate	33801801	★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of Lung	Associate	31393394, 33181687	★☆☆☆☆ Found in Text Mining only
Adrenal Hyperplasia Congenital	Associate	26075496	★☆☆☆☆ Found in Text Mining only
Afibrinogenemia	Associate	10688828, 10880389, 10891444, 11001902, 12393540, 12511408, 12871501, 13960907, 14629469, 15070682, 15613026, 15632207, 16565503, 17082318, 17650452, 17883696, 21459789, 25038212, 26039544, 27520927, 29240685, 29244742, 29286337, 30418131, 32228225, 32698516, 35054908, 40310436, 7949126, 9332319	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Afibrinogenemia	Inhibit	11001902, 15848993, 17854317, 31797863, 32584008, 40268443, 447844, 9916133	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Altitude Sickness	Associate	35616548	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Associate	30007166, 32093517, 32518112, 35695802	★☆☆☆☆ Found in Text Mining only
Amyloid Neuropathies Familial	Associate	22053176	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Associate	31924745, 8113408	★☆☆☆☆ Found in Text Mining only
Amyloidosis Familial	Associate	19073821, 29240685, 8113408, 9389696	★☆☆☆☆ Found in Text Mining only
Amyloidosis familial visceral	Associate	9389696	★☆☆☆☆ Found in Text Mining only
Amyloidosis Hereditary Transthyretin Related	Associate	26147092	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Associate	32586411, 39278909	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Associate	15346842	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Stimulate	20467748	★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Associate	18759277	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Associate	20620767, 25384012	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Associate	31055797	★☆☆☆☆ Found in Text Mining only
Arthritis	Associate	30867536	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Associate	20506214, 26684871, 27906052, 37654483, 39969330	★☆☆☆☆ Found in Text Mining only
Asthma	Stimulate	27044366	★☆☆☆☆ Found in Text Mining only
Atelosteogenesis type 2	Associate	7949126	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Associate	18772067, 19332210, 20025644, 21322770, 22836718, 39227703	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Associate	10910940, 29235504	★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Stimulate	33142286	★☆☆☆☆ Found in Text Mining only
Axial Spondyloarthritis	Associate	33317138	★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Associate	34559910	★☆☆☆☆ Found in Text Mining only
Bites Human	Associate	39560968	★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Associate	16230339, 22407772, 24178511, 24349325, 24759134, 25119470, 26658659, 27553289, 27684817, 29240685, 29518939, 30784176, 31055797, 31948701, 33991637, 36471393, 36507906, 37054625, 38003341	★☆☆☆☆ Found in Text Mining only
Blood Loss Surgical	Associate	13960907	★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Associate	12406067, 16045623, 17495120, 20031577, 21526886, 22407772, 2242424, 24203353, 25338090, 2738154, 28934202, 29242293, 29369482, 3165296, 32586411, 3818957, 8652809	★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Stimulate	7592985	★☆☆☆☆ Found in Text Mining only
Blue rubber bleb nevus syndrome	Associate	39426903	★☆☆☆☆ Found in Text Mining only
Brain Diseases	Associate	23028511	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Associate	23958057	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	25654390	★☆☆☆☆ Found in Text Mining only
Brugada Syndrome	Associate	23276942	★☆☆☆☆ Found in Text Mining only
CADASIL	Associate	35695802	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	19596924, 23826206, 30345303, 31578661	★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	23958057, 31393394	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Associate	34512814	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Associate	31393394	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Associate	29540862	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Stimulate	15737987, 20570858	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Associate	16194201, 18700015, 18818200, 19143925, 19352213, 20025644, 20059469, 20135074, 23036532, 26256740, 31055797, 31075152, 31354890, 32192491, 32492148	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carotid Artery Thrombosis	Associate	19143925	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Associate	18178454	★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Associate	32518112	★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy Familial	Associate	32518112	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Associate	15608011, 18331453, 19143925, 33367543, 33834859, 34357004, 40310436	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Stimulate	25063764, 31760390	★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Associate	32518112	★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Associate	36868481	★☆☆☆☆ Found in Text Mining only
Chromosome Xp11.3 Deletion Syndrome	Associate	34512814	★☆☆☆☆ Found in Text Mining only
Chronic Disease	Associate	28382370	★☆☆☆☆ Found in Text Mining only
Chronic Limb Threatening Ischemia	Associate	12844097	★☆☆☆☆ Found in Text Mining only
Citrulline transport defect	Associate	39560968	★☆☆☆☆ Found in Text Mining only
Clinical Deterioration	Associate	2242424	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Stimulate	29733497, 35503943	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Associate	33142286	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Associate	26581183, 33142286	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Stimulate	34183667	★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Associate	7535283	★☆☆☆☆ Found in Text Mining only
Congenital Abnormalities	Associate	10691848, 2257302	★☆☆☆☆ Found in Text Mining only
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	28382370	★☆☆☆☆ Found in Text Mining only
Contusions	Associate	12871326	★☆☆☆☆ Found in Text Mining only
Corneal Dystrophy Fleck	Associate	32228225	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Stimulate	12754559	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Associate	14681238, 16881935, 19707286, 20167083, 27553289, 28894953, 32192491, 32525847, 32584014, 37824465	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Disease	Stimulate	11418615, 18700015, 3970784	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Associate	15121769, 19352213, 21029470, 31075152, 31354890	★☆☆☆☆ Found in Text Mining only
Coronary Restenosis	Associate	27277665	★☆☆☆☆ Found in Text Mining only
Coronary Vasospasm	Associate	2768708	★☆☆☆☆ Found in Text Mining only
COVID 19	Associate	32573711, 33760664, 33804769, 35017110, 35420680, 36131342, 36555850, 36647888, 37372959	★☆☆☆☆ Found in Text Mining only
COVID 19	Stimulate	32911392, 33991637, 37390087	★☆☆☆☆ Found in Text Mining only
Critical Illness	Inhibit	35196304	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Associate	20031577	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Stimulate	34183667	★☆☆☆☆ Found in Text Mining only
Cytokine Release Syndrome	Associate	38546698	★☆☆☆☆ Found in Text Mining only
Deafness Autosomal Recessive 1b	Associate	12406067	★☆☆☆☆ Found in Text Mining only
Death	Associate	26684871	★☆☆☆☆ Found in Text Mining only
Death	Stimulate	34512814	★☆☆☆☆ Found in Text Mining only
Dementia Vascular	Associate	32093517	★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Stimulate	34488523	★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Associate	22447087	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Associate	17969370, 19332210, 25415563, 27929198, 31740441, 32192491	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Stimulate	21029470, 30256013, 33760664	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Associate	15857159, 17189536, 27929198, 32517350	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Stimulate	17189536	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Associate	9826034	★☆☆☆☆ Found in Text Mining only
Disease	Stimulate	18818200	★☆☆☆☆ Found in Text Mining only
Disease	Associate	36868481	★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Associate	1536954, 34137469, 34428280	★☆☆☆☆ Found in Text Mining only
Drug Related Side Effects and Adverse Reactions	Associate	18331966	★☆☆☆☆ Found in Text Mining only
Dysfibrinogenemia Congenital	Associate	11071644, 11159525, 1391954, 15009465, 16959688, 19420351, 19949684, 22407772, 2496144, 2738154, 27684817, 28948631, 29240685, 30290666, 3345340, 33663356, 33895794, 36401403, 37442158, 37516116, 5564389, 7493975, 8770228	★☆☆☆☆ Found in Text Mining only
Dysgeusia	Associate	40333079	★☆☆☆☆ Found in Text Mining only
Embolic Stroke	Associate	29235504	★☆☆☆☆ Found in Text Mining only
Embolism	Associate	10910940	★☆☆☆☆ Found in Text Mining only
Endocarditis	Associate	34154404, 34910783	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Stimulate	37635376	★☆☆☆☆ Found in Text Mining only
Epilepsy	Associate	33082886	★☆☆☆☆ Found in Text Mining only
Epileptic Syndromes	Stimulate	3970784	★☆☆☆☆ Found in Text Mining only
Epistaxis	Associate	9576177	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Associate	34044599	★☆☆☆☆ Found in Text Mining only
Extranodal Extension	Associate	32518112	★☆☆☆☆ Found in Text Mining only
Familial Mediterranean Fever	Associate	18408398	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Stimulate	34082137	★☆☆☆☆ Found in Text Mining only
Fever	Associate	40611069	★☆☆☆☆ Found in Text Mining only
Fibrosis	Associate	20939925	★☆☆☆☆ Found in Text Mining only
Freiberg's disease	Associate	31075152	★☆☆☆☆ Found in Text Mining only
Gastritis	Stimulate	35566209	★☆☆☆☆ Found in Text Mining only
Glaucoma Neovascular	Associate	11811587	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Associate	33694259	★☆☆☆☆ Found in Text Mining only
Glioma	Associate	33694259	★☆☆☆☆ Found in Text Mining only
Gliosis	Associate	31712085	★☆☆☆☆ Found in Text Mining only
Gray Platelet Syndrome	Associate	19410025	★☆☆☆☆ Found in Text Mining only
Hearing Loss Sensorineural	Associate	24466284	★☆☆☆☆ Found in Text Mining only
Hearing Loss Sudden	Associate	24466284	★☆☆☆☆ Found in Text Mining only
Heart Failure	Associate	18331966	★☆☆☆☆ Found in Text Mining only
Hemoglobinuria Paroxysmal	Stimulate	32311169	★☆☆☆☆ Found in Text Mining only
Hemophilia A	Inhibit	17229056	★☆☆☆☆ Found in Text Mining only
Hemophilia A	Associate	4622105	★☆☆☆☆ Found in Text Mining only
Hemorrhage	Associate	10887149, 11159525, 11468164, 1438206, 15632207, 19229055, 20386430, 20570858, 2496144, 29286337, 30145561, 30418131, 31924745, 33186848, 3345340, 33668986, 37940047	★☆☆☆☆ Found in Text Mining only
Hemorrhagic Disorders	Associate	30418131	★☆☆☆☆ Found in Text Mining only
Hepatitis Chronic	Associate	25038212	★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Stimulate	31547461	★☆☆☆☆ Found in Text Mining only
Heredodegenerative Disorders Nervous System	Associate	39209100	★☆☆☆☆ Found in Text Mining only
HIV Infections	Associate	24759134, 27495090	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Associate	32235718	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Associate	2257302, 8049427	★☆☆☆☆ Found in Text Mining only
Hypertension	Associate	19332210, 19352213, 20135074, 27553289, 38103737	★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Associate	30217946	★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Associate	32575434	★☆☆☆☆ Found in Text Mining only
Hypoalphalipoproteinemias	Associate	30418131	★☆☆☆☆ Found in Text Mining only
Hypodysfibrinogenemia Congenital	Associate	10880389, 14615374, 15632207, 16959688, 19229055, 33186848	★☆☆☆☆ Found in Text Mining only
Hypodysfibrinogenemia Congenital	Inhibit	31797863	★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Stimulate	33760664	★☆☆☆☆ Found in Text Mining only
Hypomagnesemia primary	Stimulate	37978492	★☆☆☆☆ Found in Text Mining only
Hypoprothrombinemias	Associate	8839854	★☆☆☆☆ Found in Text Mining only
Idiopathic Noncirrhotic Portal Hypertension	Associate	30145561, 34052252	★☆☆☆☆ Found in Text Mining only
IgA Vasculitis	Associate	34691039	★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Associate	17469143	★☆☆☆☆ Found in Text Mining only
Infarction	Associate	27234505	★☆☆☆☆ Found in Text Mining only
Infertility	Associate	38274228	★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	10231453, 14966045, 15120829, 15737987, 17803693, 18382655, 18426996, 18514165, 18700015, 19332210, 20031577, 20059469, 21959347, 22419864, 22447087, 22624038, 23036532, 23144326, 2318833, 24364468, 24958781, 26684871, 27352829, 27553289, 29240685, 29518939, 31547461, 31735647, 33264710, 33760664, 33804769, 35487339, 35534521, 37978492, 38583742, 9935039	★☆☆☆☆ Found in Text Mining only
Inflammation	Stimulate	11418615, 23398985, 25775429, 34910783, 37266430, 9028318	★☆☆☆☆ Found in Text Mining only
Inflammation	Inhibit	28558299	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Associate	25878173	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Associate	21959347	★☆☆☆☆ Found in Text Mining only
Intermittent Claudication	Associate	12844097, 17826235	★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Associate	33106390	★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Stimulate	35469231	★☆☆☆☆ Found in Text Mining only
Intracranial Embolism	Associate	10911375	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholestasis of Pregnancy	Associate	34559910	★☆☆☆☆ Found in Text Mining only
Ischemia	Associate	17826235	★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Stimulate	35503943	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Associate	17469143, 18408398	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Associate	12969171, 19352213	★☆☆☆☆ Found in Text Mining only
Legg Calve Perthes Disease	Associate	14629463	★☆☆☆☆ Found in Text Mining only
Leprosy	Associate	29565968	★☆☆☆☆ Found in Text Mining only
Leukemia Erythroblastic Acute	Associate	9689055	★☆☆☆☆ Found in Text Mining only
Leukemia Megakaryoblastic Acute	Associate	9694716	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Associate	33180817	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Associate	16565503, 25038212	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Inhibit	29244742	★☆☆☆☆ Found in Text Mining only
Liver Failure	Associate	17883696, 31547461	★☆☆☆☆ Found in Text Mining only
Liver Failure	Stimulate	33991637	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Associate	36555850	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	29576497, 29851300, 35341249, 39560968	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Stimulate	15934123	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Associate	30170966	★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Associate	17469143	★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Associate	27513731, 37653176, 37904401	★☆☆☆☆ Found in Text Mining only
Lymphoma	Associate	11282562	★☆☆☆☆ Found in Text Mining only
Lymphoma Non Hodgkin	Associate	25038212	★☆☆☆☆ Found in Text Mining only
Macrophage Activation Syndrome	Associate	39560968	★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development	Stimulate	31675181	★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	1707057, 2447074	★☆☆☆☆ Found in Text Mining only
Menorrhagia	Associate	10691848	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Associate	22447087, 34219465	★☆☆☆☆ Found in Text Mining only
Migraine with Aura	Associate	33795393	★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Associate	37822056	★☆☆☆☆ Found in Text Mining only
Mucocele	Associate	19429776	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Associate	37822056	★☆☆☆☆ Found in Text Mining only
Multiple Organ Failure	Associate	34137469	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Associate	23692923, 31675181, 34561786	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Stimulate	37406976, 39969330	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Associate	38040826	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Associate	12366606, 12393744, 12406067, 15709716, 17241179, 18772067, 26658659, 32879090, 33228791, 8226773, 9935039	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Stimulate	15670033, 19707286, 20467748	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Associate	16194201, 2768708	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myopathies Structural Congenital	Associate	11514957	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Associate	36507906	★☆☆☆☆ Found in Text Mining only
Necrosis	Associate	26684871	★☆☆☆☆ Found in Text Mining only
Neonatal onset citrullinemia type 2	Inhibit	34704407	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	23958057, 24294359	★☆☆☆☆ Found in Text Mining only
Neoplasms	Stimulate	10950840, 31169138	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	1374415, 17949478, 19596924, 2409935, 24294359, 29518939, 30345303, 31393394, 36647888	★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	8554971	★☆☆☆☆ Found in Text Mining only
Neoplastic Syndromes Hereditary	Inhibit	29769041	★☆☆☆☆ Found in Text Mining only
Neoplastic Syndromes Hereditary	Associate	32698516, 8839854	★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Associate	19633201, 39988003	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Associate	33142286	★☆☆☆☆ Found in Text Mining only
Neuroinflammatory Diseases	Associate	33142286, 39209100	★☆☆☆☆ Found in Text Mining only
Neurologic Manifestations	Associate	39988003	★☆☆☆☆ Found in Text Mining only
Neutrophil Immunodeficiency Syndrome	Associate	26684871	★☆☆☆☆ Found in Text Mining only
Non alcoholic Fatty Liver Disease	Associate	26256740	★☆☆☆☆ Found in Text Mining only
Obesity	Associate	17582472, 21029470, 21959347, 32214403	★☆☆☆☆ Found in Text Mining only
Obesity	Stimulate	25914268, 30536591, 30658193, 33668851	★☆☆☆☆ Found in Text Mining only
Obesity Morbid	Stimulate	37266430	★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Associate	16735602	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Associate	39684216	★☆☆☆☆ Found in Text Mining only
Osteogenesis imperfecta type 1A	Associate	12406067, 33106390	★☆☆☆☆ Found in Text Mining only
Osteopenic Nonfracture Syndrome	Inhibit	36053959	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Associate	34977236	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporotic Fractures	Associate	36053959	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Associate	23720361	★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Associate	28534980	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Stimulate	33277847	★☆☆☆☆ Found in Text Mining only
Pain Postoperative	Associate	29242293	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	17012836	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Associate	37939393	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Paroxysmal ventricular fibrillation	Associate	27759448	★☆☆☆☆ Found in Text Mining only
Penile Induration	Associate	447844	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Associate	16443741, 23235487	★☆☆☆☆ Found in Text Mining only
Persistent Vegetative State	Associate	19698862	★☆☆☆☆ Found in Text Mining only
Platelet Aggregation Spontaneous	Associate	2932469	★☆☆☆☆ Found in Text Mining only
Pleural Effusion Malignant	Associate	16899477	★☆☆☆☆ Found in Text Mining only
Pneumonia	Associate	40611069	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Associate	22035022, 28534980	★☆☆☆☆ Found in Text Mining only
Porencephaly	Associate	2496144	★☆☆☆☆ Found in Text Mining only
Post Acute COVID 19 Syndrome	Inhibit	37047497	★☆☆☆☆ Found in Text Mining only
Post Infectious Disorders	Associate	30145561	★☆☆☆☆ Found in Text Mining only
Pre Eclampsia	Stimulate	22570525	★☆☆☆☆ Found in Text Mining only
Pre Eclampsia	Associate	28558299	★☆☆☆☆ Found in Text Mining only
Proteinuria	Associate	18408398	★☆☆☆☆ Found in Text Mining only
Psoriasis	Associate	20031577	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Stimulate	19272152, 20500811, 25709430	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Associate	22419864, 22701684, 30217946, 33910578, 35534521	★☆☆☆☆ Found in Text Mining only
Pulmonary Embolism	Associate	10910940, 12871327, 19363122, 19420351, 33128086, 36890726	★☆☆☆☆ Found in Text Mining only
Purpura Thrombocytopenic Idiopathic	Associate	28409645	★☆☆☆☆ Found in Text Mining only
Quebec platelet disorder	Inhibit	18791940	★☆☆☆☆ Found in Text Mining only
Red Cell Aplasia Pure	Associate	29662311	★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Associate	24332189	★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome	Associate	25254322	★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Associate	31169138	★☆☆☆☆ Found in Text Mining only
Retinal Perforations	Associate	37530283	★☆☆☆☆ Found in Text Mining only
Retinal Vein Occlusion	Associate	33270842, 36820679	★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Associate	39201484	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Associate	24743863	★☆☆☆☆ Found in Text Mining only
Signs and Symptoms	Associate	23958057	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Associate	447844	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Syndromes	Associate	20508215	★☆☆☆☆ Found in Text Mining only
Smoke Inhalation Injury	Stimulate	21818732	★☆☆☆☆ Found in Text Mining only
Smoke Inhalation Injury	Associate	24957141	★☆☆☆☆ Found in Text Mining only
Smoldering Multiple Myeloma	Associate	37822056	★☆☆☆☆ Found in Text Mining only
ST Elevation Myocardial Infarction	Stimulate	25487289	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	26662807, 29518939	★☆☆☆☆ Found in Text Mining only
Stroke	Associate	11260063, 15608011, 21499712, 24090469, 24957141, 37673933, 39988003, 8226773	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Syndrome	Associate	10910944	★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Associate	34523592	★☆☆☆☆ Found in Text Mining only
Tang Hsi Ryu syndrome	Associate	21923924	★☆☆☆☆ Found in Text Mining only
Tertiary Lymphoid Structures	Stimulate	31169138	★☆☆☆☆ Found in Text Mining only
Thrombasthenia	Associate	12199799, 12472580, 12941045, 1438206, 1602006, 23995838, 2539213, 40239810, 8049427, 9351872	★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Stimulate	28397442	★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Associate	31856623	★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Associate	27365488, 34137469	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombocytopenia Neonatal Alloimmune	Associate	11830467	★☆☆☆☆ Found in Text Mining only
Thromboembolism	Associate	15070682	★☆☆☆☆ Found in Text Mining only
Thromboinflammation	Associate	37390087	★☆☆☆☆ Found in Text Mining only
Thrombophilia	Associate	1634610, 17650452, 26581183, 37390087, 8473507	★☆☆☆☆ Found in Text Mining only
Thrombophilia	Stimulate	29308659	★☆☆☆☆ Found in Text Mining only
Thrombophilia due to Activated Protein C Resistance	Associate	15070682	★☆☆☆☆ Found in Text Mining only
Thrombophilia hereditary	Associate	1634610	★☆☆☆☆ Found in Text Mining only
Thrombophlebitis	Associate	40397612	★☆☆☆☆ Found in Text Mining only
Thrombosis	Associate	10910940, 10911375, 14681238, 15709716, 16881935, 17582472, 18665927, 18700015, 19058807, 19698862, 20031577, 20467748, 24758255, 24759134, 27929198, 30418131, 3156856, 31924745, 33367543, 33424834, 33895794, 36131342, 36647888, 37087333, 37940047, 40310436, 7949126, 8473507, 8770228	★☆☆☆☆ Found in Text Mining only
Tibial Meniscus Injuries	Associate	31484330	★☆☆☆☆ Found in Text Mining only
Tomaculous neuropathy	Associate	13960907	★☆☆☆☆ Found in Text Mining only
Triglyceride Storage Disease Type I	Stimulate	33760664	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Associate	22159600	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Associate	20031577, 27929198	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Associate	27929198	★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Associate	10910940, 12752105, 24804362, 26581183, 33367543, 36507737, 37762110	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Venous Thromboembolism	Inhibit	33834859	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Venous Thrombosis	Associate	10910940, 1634610, 17038160, 17582472, 27812779, 29286337, 29851809, 34142473, 34583575	★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Stimulate	20096009	★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Inhibit	20156641	★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Associate	31347309	★☆☆☆☆ Found in Text Mining only
White Coat Hypertension	Inhibit	25098164	★☆☆☆☆ Found in Text Mining only
Zinc Deficiency Neonatal due to Low Breast Milk Zinc	Stimulate	37566973	★☆☆☆☆ Found in Text Mining only