Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2244
Gene name	Fibrinogen beta chain
Gene symbol	FGB
Synonyms (NCBI Gene)	HEL-S-78p
Chromosome	4
Chromosome location	4q31.3
Summary	The protein encoded by this gene is the beta component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abu

Show/Hide all (10)

SNP ID	Visualize variation	Clinical significance	Consequence
rs6054	C>T	Likely-benign, likely-pathogenic, pathogenic, uncertain-significance	Coding sequence variant, missense variant
rs121909616	C>T	Other, likely-pathogenic	Missense variant, coding sequence variant
rs121909621	T>G	Pathogenic	Missense variant, coding sequence variant
rs121909622	G>A	Pathogenic	Missense variant, coding sequence variant
rs121909624	T>A,C	Pathogenic	Missense variant, coding sequence variant
rs121909625	C>T	Pathogenic, likely-pathogenic	Stop gained, coding sequence variant
rs606231223	C>T	Pathogenic	Intron variant
rs606231224	G>T	Pathogenic	Splice donor variant
rs1578783532	T>C	Pathogenic	Coding sequence variant, missense variant
rs1578785111	G>C	Pathogenic	Coding sequence variant, missense variant

145

Show/Hide all (145)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005517	hsa-miR-409-3p	ELISAFlowLuciferase reporter assay	20570858
MIRT005526	hsa-miR-29c-3p	Luciferase reporter assay	20570858
MIRT005530	hsa-miR-144-3p	Luciferase reporter assay	20570858
MIRT005532	hsa-miR-29a-3p	Luciferase reporter assay	20570858
MIRT005534	hsa-miR-29b-3p	Luciferase reporter assay	20570858
MIRT005526	hsa-miR-29c-3p	Luciferase reporter assay	20570858
MIRT518174	hsa-miR-6890-5p	PAR-CLIP	23446348
MIRT518173	hsa-miR-3155a	PAR-CLIP	23446348
MIRT518172	hsa-miR-3155b	PAR-CLIP	23446348
MIRT518171	hsa-miR-484	PAR-CLIP	23446348
MIRT518170	hsa-miR-1279	PAR-CLIP	23446348
MIRT518169	hsa-miR-193b-5p	PAR-CLIP	23446348
MIRT518168	hsa-miR-6801-5p	PAR-CLIP	23446348
MIRT518167	hsa-miR-6832-5p	PAR-CLIP	23446348
MIRT518166	hsa-miR-197-3p	PAR-CLIP	23446348
MIRT518165	hsa-miR-3170	PAR-CLIP	23446348
MIRT518164	hsa-miR-6855-5p	PAR-CLIP	23446348
MIRT518163	hsa-miR-5587-5p	PAR-CLIP	23446348
MIRT518162	hsa-miR-5096	PAR-CLIP	23446348
MIRT518174	hsa-miR-6890-5p	PAR-CLIP	23446348
MIRT518173	hsa-miR-3155a	PAR-CLIP	23446348
MIRT518172	hsa-miR-3155b	PAR-CLIP	23446348
MIRT518171	hsa-miR-484	PAR-CLIP	23446348
MIRT518170	hsa-miR-1279	PAR-CLIP	23446348
MIRT518169	hsa-miR-193b-5p	PAR-CLIP	23446348
MIRT518168	hsa-miR-6801-5p	PAR-CLIP	23446348
MIRT518167	hsa-miR-6832-5p	PAR-CLIP	23446348
MIRT518166	hsa-miR-197-3p	PAR-CLIP	23446348
MIRT518165	hsa-miR-3170	PAR-CLIP	23446348
MIRT518164	hsa-miR-6855-5p	PAR-CLIP	23446348
MIRT518163	hsa-miR-5587-5p	PAR-CLIP	23446348
MIRT518162	hsa-miR-5096	PAR-CLIP	23446348
MIRT995121	hsa-miR-122	CLIP-seq
MIRT995122	hsa-miR-1273f	CLIP-seq
MIRT995123	hsa-miR-1289	CLIP-seq
MIRT995124	hsa-miR-129-5p	CLIP-seq
MIRT995125	hsa-miR-1304	CLIP-seq
MIRT995126	hsa-miR-197	CLIP-seq
MIRT995127	hsa-miR-3135b	CLIP-seq
MIRT995128	hsa-miR-3155	CLIP-seq
MIRT995129	hsa-miR-3198	CLIP-seq
MIRT995130	hsa-miR-3199	CLIP-seq
MIRT995131	hsa-miR-3652	CLIP-seq
MIRT995132	hsa-miR-4269	CLIP-seq
MIRT995133	hsa-miR-4294	CLIP-seq
MIRT995134	hsa-miR-4309	CLIP-seq
MIRT995135	hsa-miR-4423-5p	CLIP-seq
MIRT995136	hsa-miR-4430	CLIP-seq
MIRT995137	hsa-miR-4438	CLIP-seq
MIRT995138	hsa-miR-4715-3p	CLIP-seq
MIRT995139	hsa-miR-4722-3p	CLIP-seq
MIRT995140	hsa-miR-4794	CLIP-seq
MIRT995141	hsa-miR-5095	CLIP-seq
MIRT995142	hsa-miR-1267	CLIP-seq
MIRT995143	hsa-miR-150	CLIP-seq
MIRT995126	hsa-miR-197	CLIP-seq
MIRT995144	hsa-miR-203	CLIP-seq
MIRT995145	hsa-miR-3147	CLIP-seq
MIRT995128	hsa-miR-3155	CLIP-seq
MIRT995146	hsa-miR-320a	CLIP-seq
MIRT995147	hsa-miR-320b	CLIP-seq
MIRT995148	hsa-miR-320c	CLIP-seq
MIRT995149	hsa-miR-320d	CLIP-seq
MIRT995150	hsa-miR-3545-3p	CLIP-seq
MIRT995151	hsa-miR-3619-3p	CLIP-seq
MIRT995152	hsa-miR-3654	CLIP-seq
MIRT995153	hsa-miR-3663-5p	CLIP-seq
MIRT995154	hsa-miR-4252	CLIP-seq
MIRT995155	hsa-miR-4425	CLIP-seq
MIRT995156	hsa-miR-4429	CLIP-seq
MIRT995157	hsa-miR-450b-3p	CLIP-seq
MIRT995158	hsa-miR-4635	CLIP-seq
MIRT995159	hsa-miR-4680-5p	CLIP-seq
MIRT995160	hsa-miR-4707-3p	CLIP-seq
MIRT995161	hsa-miR-4742-3p	CLIP-seq
MIRT995162	hsa-miR-4776-5p	CLIP-seq
MIRT995163	hsa-miR-520g	CLIP-seq
MIRT995164	hsa-miR-520h	CLIP-seq
MIRT995165	hsa-miR-653	CLIP-seq
MIRT995166	hsa-miR-769-3p	CLIP-seq
MIRT995122	hsa-miR-1273f	CLIP-seq
MIRT995126	hsa-miR-197	CLIP-seq
MIRT995128	hsa-miR-3155	CLIP-seq
MIRT995150	hsa-miR-3545-3p	CLIP-seq
MIRT995153	hsa-miR-3663-5p	CLIP-seq
MIRT995158	hsa-miR-4635	CLIP-seq
MIRT995159	hsa-miR-4680-5p	CLIP-seq
MIRT995123	hsa-miR-1289	CLIP-seq
MIRT995124	hsa-miR-129-5p	CLIP-seq
MIRT1995077	hsa-miR-1302	CLIP-seq
MIRT995125	hsa-miR-1304	CLIP-seq
MIRT1995078	hsa-miR-1825	CLIP-seq
MIRT1995079	hsa-miR-199a-5p	CLIP-seq
MIRT1995080	hsa-miR-199b-5p	CLIP-seq
MIRT995129	hsa-miR-3198	CLIP-seq
MIRT995130	hsa-miR-3199	CLIP-seq
MIRT1995081	hsa-miR-3925-3p	CLIP-seq
MIRT995132	hsa-miR-4269	CLIP-seq
MIRT995133	hsa-miR-4294	CLIP-seq
MIRT1995082	hsa-miR-4298	CLIP-seq
MIRT995134	hsa-miR-4309	CLIP-seq
MIRT1995083	hsa-miR-432	CLIP-seq
MIRT995137	hsa-miR-4438	CLIP-seq
MIRT1995084	hsa-miR-4648	CLIP-seq
MIRT995138	hsa-miR-4715-3p	CLIP-seq
MIRT995139	hsa-miR-4722-3p	CLIP-seq
MIRT1995085	hsa-miR-4735-5p	CLIP-seq
MIRT1995086	hsa-miR-4775	CLIP-seq
MIRT995140	hsa-miR-4794	CLIP-seq
MIRT995141	hsa-miR-5095	CLIP-seq
MIRT1995087	hsa-miR-590-3p	CLIP-seq
MIRT995122	hsa-miR-1273f	CLIP-seq
MIRT2449652	hsa-miR-3149	CLIP-seq
MIRT2449653	hsa-miR-411	CLIP-seq
MIRT2449654	hsa-miR-4328	CLIP-seq
MIRT995138	hsa-miR-4715-3p	CLIP-seq
MIRT995139	hsa-miR-4722-3p	CLIP-seq
MIRT1995085	hsa-miR-4735-5p	CLIP-seq
MIRT1995086	hsa-miR-4775	CLIP-seq
MIRT995140	hsa-miR-4794	CLIP-seq
MIRT1995087	hsa-miR-590-3p	CLIP-seq
MIRT995122	hsa-miR-1273f	CLIP-seq
MIRT995126	hsa-miR-197	CLIP-seq
MIRT2449652	hsa-miR-3149	CLIP-seq
MIRT2449653	hsa-miR-411	CLIP-seq
MIRT995138	hsa-miR-4715-3p	CLIP-seq
MIRT995139	hsa-miR-4722-3p	CLIP-seq
MIRT1995085	hsa-miR-4735-5p	CLIP-seq
MIRT1995086	hsa-miR-4775	CLIP-seq
MIRT995140	hsa-miR-4794	CLIP-seq
MIRT1995087	hsa-miR-590-3p	CLIP-seq
MIRT995122	hsa-miR-1273f	CLIP-seq
MIRT995126	hsa-miR-197	CLIP-seq
MIRT2449652	hsa-miR-3149	CLIP-seq
MIRT995130	hsa-miR-3199	CLIP-seq
MIRT2449653	hsa-miR-411	CLIP-seq
MIRT995132	hsa-miR-4269	CLIP-seq
MIRT995137	hsa-miR-4438	CLIP-seq
MIRT995138	hsa-miR-4715-3p	CLIP-seq
MIRT995139	hsa-miR-4722-3p	CLIP-seq
MIRT1995085	hsa-miR-4735-5p	CLIP-seq
MIRT1995086	hsa-miR-4775	CLIP-seq
MIRT995140	hsa-miR-4794	CLIP-seq
MIRT995141	hsa-miR-5095	CLIP-seq
MIRT1995087	hsa-miR-590-3p	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
FOXM1	Repression	15737987

Show/Hide all (61)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0005102	Function	Signaling receptor binding	IDA	10903502
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005198	Function	Structural molecule activity	IDA	8910396
GO:0005201	Function	Extracellular matrix structural constituent	HDA	28344315
GO:0005201	Function	Extracellular matrix structural constituent	RCA	25037231, 28327460, 28675934
GO:0005515	Function	Protein binding	IPI	12706644, 20162731
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005576	Component	Extracellular region	TAS
GO:0005577	Component	Fibrinogen complex	IDA	6688356, 8910396, 16846481, 18676163
GO:0005577	Component	Fibrinogen complex	IEA
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	6777381, 19996109
GO:0005615	Component	Extracellular space	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005886	Component	Plasma membrane	TAS
GO:0005938	Component	Cell cortex	IEA
GO:0007160	Process	Cell-matrix adhesion	IBA
GO:0007160	Process	Cell-matrix adhesion	IDA	10903502
GO:0007596	Process	Blood coagulation	IEA
GO:0007599	Process	Hemostasis	IEA
GO:0009897	Component	External side of plasma membrane	IDA	6777381
GO:0009986	Component	Cell surface	IDA	6777381
GO:0030168	Process	Platelet activation	IEA
GO:0031012	Component	Extracellular matrix	HDA	25037231, 28327460, 28344315, 28675934
GO:0031012	Component	Extracellular matrix	IBA
GO:0031091	Component	Platelet alpha granule	IDA	6777381
GO:0031093	Component	Platelet alpha granule lumen	TAS
GO:0031639	Process	Plasminogen activation	IDA	16846481
GO:0034116	Process	Positive regulation of heterotypic cell-cell adhesion	IDA	8100742
GO:0042730	Process	Fibrinolysis	IDA	16846481
GO:0043152	Process	Induction of bacterial agglutination	IDA	24367264
GO:0044320	Process	Cellular response to leptin stimulus	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045202	Component	Synapse	IEA
GO:0045907	Process	Positive regulation of vasoconstriction	IDA	15739255
GO:0045921	Process	Positive regulation of exocytosis	IDA	19193866
GO:0050714	Process	Positive regulation of protein secretion	IDA	19193866
GO:0050839	Function	Cell adhesion molecule binding	IDA	9182580
GO:0051087	Function	Protein-folding chaperone binding	IPI	19996109
GO:0051258	Process	Protein polymerization	IDA	12706644
GO:0051258	Process	Protein polymerization	IEA
GO:0051592	Process	Response to calcium ion	IDA	6777381
GO:0065003	Process	Protein-containing complex assembly	IDA	8910396
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	10903502, 19193866
GO:0070527	Process	Platelet aggregation	IBA
GO:0070527	Process	Platelet aggregation	IDA	6281794
GO:0071347	Process	Cellular response to interleukin-1	IEA
GO:0072378	Process	Blood coagulation, fibrin clot formation	IBA
GO:0072378	Process	Blood coagulation, fibrin clot formation	IDA	16846481
GO:0072562	Component	Blood microparticle	HDA	22516433
GO:0072562	Component	Blood microparticle	IEA
GO:0090277	Process	Positive regulation of peptide hormone secretion	IDA	19193866
GO:1900026	Process	Positive regulation of substrate adhesion-dependent cell spreading	NAS	24041635
GO:1902042	Process	Negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IDA	10903502
GO:1903561	Component	Extracellular vesicle	HDA	24769233
GO:2000352	Process	Negative regulation of endothelial cell apoptotic process	IDA	10903502

MIM	HGNC	e!Ensembl
134830	3662	ENSG00000171564

P02675

Protein name

Fibrinogen beta chain [Cleaved into: Fibrinopeptide B; Fibrinogen beta chain]

Protein function

Cleaved by the protease thrombin to yield monomers which, together with fibrinogen alpha (FGA) and fibrinogen gamma (FGG), polymerize to form an insoluble fibrin matrix. Fibrin has a major function in hemostasis as one of the primary components

PDB

1FZA , 1FZB , 1FZC , 1FZE , 1FZF , 1FZG , 1LT9 , 1LTJ , 1N86 , 1N8E , 1RE3 , 1RE4 , 1RF0 , 1RF1 , 2A45 , 2FFD , 2H43 , 2HLO , 2HOD , 2HPC , 2OYH , 2OYI , 2Q9I , 2XNX , 2XNY , 2Z4E , 3BVH , 3E1I , 3GHG , 3H32 , 3HUS , 6ATZ , 6BIJ , 6BIL , 6V0Y , 6V13 , 6V15 , 6V18 , 6V19 , 6V1A

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08702	Fib_alpha	91 → 234	Fibrinogen alpha/beta chain family	Coiled-coil
PF00147	Fibrinogen_C	237 → 487	Fibrinogen beta and gamma chains, C-terminal globular domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in blood plasma (at protein level). {ECO:0000269|PubMed:10074346, ECO:0000269|PubMed:19296670, ECO:0000269|PubMed:9628725}.

Sequence

MKRMVSWSFHKLKTMKHLLLLLLCVFLVKSQGVNDNEEGFFSARGHRPLDKKREEAPSLR
PAPPPISGGGYRARPAKAAATQKKVERKAPDAGGCLHADPDLGVLCPTGCQLQEALLQQE
RPIRNSVDELNNNVEAVSQTSSSSFQYMYLLKDLWQKRQKQVKDNENVVNEYSSELEKHQ
LYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKE
CEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYK
QGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFT
VQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDP
RKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKM
SMKIRPFFPQQ

Sequence length

491

Interactions

View interactions

	KEGG		Reactome
	Complement and coagulation cascades Platelet activation Neutrophil extracellular trap formation Coronavirus disease - COVID-19		Platelet degranulation Common Pathway of Fibrin Clot Formation Integrin cell surface interactions Integrin signaling GRB2:SOS provides linkage to MAPK signaling for Integrins p130Cas linkage to MAPK signaling for integrins MAP2K and MAPK activation Regulation of TLR by endogenous ligand Signaling by moderate kinase activity BRAF mutants Signaling by high-kinase activity BRAF mutants Signaling by BRAF and RAF fusions Paradoxical activation of RAF signaling by kinase inactive BRAF Signaling downstream of RAS mutants

160

Show/Hide Causal Diseases (7)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Afibrinogenemia	Likely pathogenic; Pathogenic	rs121909625	RCV002243650
Congenital afibrinogenemia	Pathogenic; Likely pathogenic	rs121909621, rs121909622, rs606231223, rs606231224, rs121909624, rs121909625, rs1578785111	RCV000017815 RCV000017816 RCV000017818 RCV000017819 RCV000017821 RCV000017822 RCV000984797
Familial dysfibrinogenemia	Likely pathogenic; Pathogenic	rs2530775972, rs1578783532, rs111502670	RCV003493346 RCV000984798 RCV001260487
FGB-related disorder	Likely pathogenic	rs2530775972, rs2530766247	RCV004747302 RCV003898936
FIBRINOGEN CHRISTCHURCH 2	Likely pathogenic	rs121909616	RCV000017804
Hypofibrinogenemia	Likely pathogenic; Pathogenic	rs121909616, rs121909625	RCV000852015 RCV000851927
See cases	Likely pathogenic	rs121909616	RCV004584330

Show/Hide Unknown Diseases (18)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Abnormal bleeding	Conflicting classifications of pathogenicity; Uncertain significance	rs6054, rs1578782707, rs763287118	RCV000851949 RCV000852140 RCV000851973
Cholangiocarcinoma	Benign; Likely benign	rs2227412, rs140114081	RCV005921758 RCV005869172
Colon adenocarcinoma	Benign; Likely benign	rs6057	RCV005897763
Colorectal cancer	Benign; Likely benign	rs6057	RCV005897764
Deep venous thrombosis	Conflicting classifications of pathogenicity; Uncertain significance	rs201909029, rs1578784790	RCV000852154 RCV000851902
FIBRINOGEN BALTIMORE 2	Benign	rs4220	RCV000017808
FIBRINOGEN ISE	other	rs121909618	RCV000017809
FIBRINOGEN LONGMONT	Uncertain significance	rs121909623	RCV000017817
FIBRINOGEN NAPLES	other	rs121909620	RCV000017811
FIBRINOGEN NIJMEGEN	other	rs121909619	RCV000119098
FIBRINOGEN PONTOISE 2	other	rs121909617	RCV000017807
FIBRINOGEN, BETA-148 POLYMORPHISM	Benign	rs1800787	RCV001843309
FIBRINOGEN-BETA POLYMORPHISM	Benign	rs1800790	RCV000017814
Gastric cancer	Benign; Likely benign	rs6057	RCV005897765
Hepatocellular carcinoma	Uncertain significance	rs763287118	RCV005897363
Lung cancer	Benign; Likely benign	rs6057	RCV005897766
Thrombocytopenia	Conflicting classifications of pathogenicity	rs6054	RCV001270563
Thrombus	Conflicting classifications of pathogenicity	rs6054	RCV002280881

Show/Hide Text Mining Associations (296)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
AA amyloidosis	Associate	16221199, 37353960
Abortion Habitual	Associate	18759277
Abortion Spontaneous	Associate	19229055, 9332319
Abruptio Placentae	Associate	13960907
Acute Coronary Syndrome	Associate	24203353
Acute Disease	Stimulate	24335474
Acute Kidney Injury	Associate	33801801
Adenocarcinoma of Lung	Associate	31393394, 33181687
Adrenal Hyperplasia Congenital	Associate	26075496
Afibrinogenemia	Associate	10688828, 10880389, 10891444, 11001902, 12393540, 12511408, 12871501, 13960907, 14629469, 15070682, 15613026, 15632207, 16565503, 17082318, 17650452 View all (15 more)
Afibrinogenemia	Inhibit	11001902, 15848993, 17854317, 31797863, 32584008, 40268443, 447844, 9916133
Altitude Sickness	Associate	35616548
Alzheimer Disease	Associate	30007166, 32093517, 32518112, 35695802
Amyloid Neuropathies Familial	Associate	22053176
Amyloidosis	Associate	31924745, 8113408
Amyloidosis Familial	Associate	19073821, 29240685, 8113408, 9389696
Amyloidosis familial visceral	Associate	9389696
Amyloidosis Hereditary Transthyretin Related	Associate	26147092
Amyotrophic Lateral Sclerosis	Associate	32586411, 39278909
Angina Unstable	Associate	15346842
Angina Unstable	Stimulate	20467748
Antiphospholipid Syndrome	Associate	18759277
Aortic Aneurysm Abdominal	Associate	20620767, 25384012
Arteriosclerosis	Associate	31055797
Arthritis	Associate	30867536
Arthritis Rheumatoid	Associate	20506214, 26684871, 27906052, 37654483, 39969330
Asthma	Stimulate	27044366
Atelosteogenesis type 2	Associate	7949126
Atherosclerosis	Associate	18772067, 19332210, 20025644, 21322770, 22836718, 39227703
Atrial Fibrillation	Associate	10910940, 29235504
Attention Deficit Disorder with Hyperactivity	Stimulate	33142286
Axial Spondyloarthritis	Associate	33317138
beta Thalassemia	Associate	34559910
Bites Human	Associate	39560968
Blood Coagulation Disorders	Associate	16230339, 22407772, 24178511, 24349325, 24759134, 25119470, 26658659, 27553289, 27684817, 29240685, 29518939, 30784176, 31055797, 31948701, 33991637 View all (4 more)
Blood Loss Surgical	Associate	13960907
Blood Platelet Disorders	Associate	12406067, 16045623, 17495120, 20031577, 21526886, 22407772, 2242424, 24203353, 25338090, 2738154, 28934202, 29242293, 29369482, 3165296, 32586411, 3818957, 8652809 View all (2 more)
Blood Platelet Disorders	Stimulate	7592985
Blue rubber bleb nevus syndrome	Associate	39426903
Brain Diseases	Associate	23028511
Brain Neoplasms	Associate	23958057
Breast Neoplasms	Associate	25654390
Brugada Syndrome	Associate	23276942
CADASIL	Associate	35695802
Carcinoma Hepatocellular	Associate	19596924, 23826206, 30345303, 31578661
Carcinoma Non Small Cell Lung	Associate	23958057, 31393394
Carcinoma Renal Cell	Associate	34512814
Carcinoma Squamous Cell	Associate	31393394
Cardiomyopathy Dilated	Associate	29540862
Cardiovascular Diseases	Stimulate	15737987, 20570858
Cardiovascular Diseases	Associate	16194201, 18700015, 18818200, 19143925, 19352213, 20025644, 20059469, 20135074, 23036532, 26256740, 31055797, 31075152, 31354890, 32192491, 32492148
Carotid Artery Thrombosis	Associate	19143925
Carotid Stenosis	Associate	18178454
Cerebral Amyloid Angiopathy	Associate	32518112
Cerebral Amyloid Angiopathy Familial	Associate	32518112
Cerebral Infarction	Associate	15608011, 18331453, 19143925, 33367543, 33834859, 34357004, 40310436
Cerebral Infarction	Stimulate	25063764, 31760390
Cerebrovascular Disorders	Associate	32518112
Cholangitis Sclerosing	Associate	36868481
Chromosome Xp11.3 Deletion Syndrome	Associate	34512814
Chronic Disease	Associate	28382370
Chronic Limb Threatening Ischemia	Associate	12844097
Citrulline transport defect	Associate	39560968
Clinical Deterioration	Associate	2242424
Cognition Disorders	Stimulate	29733497, 35503943
Cognition Disorders	Associate	33142286
Cognitive Dysfunction	Associate	26581183, 33142286
Colitis Ulcerative	Stimulate	34183667
Colonic Diseases	Associate	7535283
Congenital Abnormalities	Associate	10691848, 2257302
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	28382370
Contusions	Associate	12871326
Corneal Dystrophy Fleck	Associate	32228225
Coronary Artery Disease	Stimulate	12754559
Coronary Artery Disease	Associate	14681238, 16881935, 19707286, 20167083, 27553289, 28894953, 32192491, 32525847, 32584014, 37824465
Coronary Disease	Stimulate	11418615, 18700015, 3970784
Coronary Disease	Associate	15121769, 19352213, 21029470, 31075152, 31354890
Coronary Restenosis	Associate	27277665
Coronary Vasospasm	Associate	2768708
COVID 19	Associate	32573711, 33760664, 33804769, 35017110, 35420680, 36131342, 36555850, 36647888, 37372959
COVID 19	Stimulate	32911392, 33991637, 37390087
Critical Illness	Inhibit	35196304
Crohn Disease	Associate	20031577
Crohn Disease	Stimulate	34183667
Cytokine Release Syndrome	Associate	38546698
Deafness Autosomal Recessive 1b	Associate	12406067
Death	Associate	26684871
Death	Stimulate	34512814
Dementia Vascular	Associate	32093517
Depressive Disorder	Stimulate	34488523
Depressive Disorder Major	Associate	22447087
Diabetes Mellitus	Associate	17969370, 19332210, 25415563, 27929198, 31740441, 32192491
Diabetes Mellitus	Stimulate	21029470, 30256013, 33760664
Diabetes Mellitus Type 2	Associate	15857159, 17189536, 27929198, 32517350
Diabetes Mellitus Type 2	Stimulate	17189536
Diabetic Retinopathy	Associate	9826034
Disease	Stimulate	18818200
Disease	Associate	36868481
Disseminated Intravascular Coagulation	Associate	1536954, 34137469, 34428280
Drug Related Side Effects and Adverse Reactions	Associate	18331966
Dysfibrinogenemia Congenital	Associate	11071644, 11159525, 1391954, 15009465, 16959688, 19420351, 19949684, 22407772, 2496144, 2738154, 27684817, 28948631, 29240685, 30290666, 3345340 View all (8 more)
Dysgeusia	Associate	40333079
Embolic Stroke	Associate	29235504
Embolism	Associate	10910940
Endocarditis	Associate	34154404, 34910783
Endometrial Neoplasms	Stimulate	37635376
Epilepsy	Associate	33082886
Epileptic Syndromes	Stimulate	3970784
Epistaxis	Associate	9576177
Esophageal Squamous Cell Carcinoma	Associate	34044599
Extranodal Extension	Associate	32518112
Familial Mediterranean Fever	Associate	18408398
Fatty Liver	Stimulate	34082137
Fever	Associate	40611069
Fibrosis	Associate	20939925
Freiberg's disease	Associate	31075152
Gastritis	Stimulate	35566209
Glaucoma Neovascular	Associate	11811587
Glioblastoma	Associate	33694259
Glioma	Associate	33694259
Gliosis	Associate	31712085
Gray Platelet Syndrome	Associate	19410025
Hearing Loss Sensorineural	Associate	24466284
Hearing Loss Sudden	Associate	24466284
Heart Failure	Associate	18331966
Hemoglobinuria Paroxysmal	Stimulate	32311169
Hemophilia A	Inhibit	17229056
Hemophilia A	Associate	4622105
Hemorrhage	Associate	10887149, 11159525, 11468164, 1438206, 15632207, 19229055, 20386430, 20570858, 2496144, 29286337, 30145561, 30418131, 31924745, 33186848, 3345340, 33668986, 37940047 View all (2 more)
Hemorrhagic Disorders	Associate	30418131
Hepatitis Chronic	Associate	25038212
Hepatolenticular Degeneration	Stimulate	31547461
Heredodegenerative Disorders Nervous System	Associate	39209100
HIV Infections	Associate	24759134, 27495090
Hodgkin Disease	Associate	32235718
Hypersensitivity Immediate	Associate	2257302, 8049427
Hypertension	Associate	19332210, 19352213, 20135074, 27553289, 38103737
Hypertension Pulmonary	Associate	30217946
Hyperthyroidism	Associate	32575434
Hypoalphalipoproteinemias	Associate	30418131
Hypodysfibrinogenemia Congenital	Associate	10880389, 14615374, 15632207, 16959688, 19229055, 33186848
Hypodysfibrinogenemia Congenital	Inhibit	31797863
Hypoglycemia	Stimulate	33760664
Hypomagnesemia primary	Stimulate	37978492
Hypoprothrombinemias	Associate	8839854
Idiopathic Noncirrhotic Portal Hypertension	Associate	30145561, 34052252
IgA Vasculitis	Associate	34691039
Immunologic Deficiency Syndromes	Associate	17469143
Infarction	Associate	27234505
Infertility	Associate	38274228
Inflammation	Associate	10231453, 14966045, 15120829, 15737987, 17803693, 18382655, 18426996, 18514165, 18700015, 19332210, 20031577, 20059469, 21959347, 22419864, 22447087 View all (21 more)
Inflammation	Stimulate	11418615, 23398985, 25775429, 34910783, 37266430, 9028318
Inflammation	Inhibit	28558299
Inflammatory Bowel Diseases	Associate	25878173
Insulin Resistance	Associate	21959347
Intermittent Claudication	Associate	12844097, 17826235
Intracranial Aneurysm	Associate	33106390
Intracranial Aneurysm	Stimulate	35469231
Intracranial Embolism	Associate	10911375
Intrahepatic Cholestasis of Pregnancy	Associate	34559910
Ischemia	Associate	17826235
Ischemic Stroke	Stimulate	35503943
Kidney Diseases	Associate	17469143, 18408398
Kidney Failure Chronic	Associate	12969171, 19352213
Legg Calve Perthes Disease	Associate	14629463
Leprosy	Associate	29565968
Leukemia Erythroblastic Acute	Associate	9689055
Leukemia Megakaryoblastic Acute	Associate	9694716
Liver Cirrhosis Biliary	Associate	33180817
Liver Diseases	Associate	16565503, 25038212
Liver Diseases	Inhibit	29244742
Liver Failure	Associate	17883696, 31547461
Liver Failure	Stimulate	33991637
Lung Diseases	Associate	36555850
Lung Neoplasms	Associate	29576497, 29851300, 35341249, 39560968
Lupus Erythematosus Systemic	Stimulate	15934123
Lupus Erythematosus Systemic	Associate	30170966
Lupus Nephritis	Associate	17469143
Lymphohistiocytosis Hemophagocytic	Associate	27513731, 37653176, 37904401
Lymphoma	Associate	11282562
Lymphoma Non Hodgkin	Associate	25038212
Macrophage Activation Syndrome	Associate	39560968
Malformations of Cortical Development	Stimulate	31675181
Melanoma	Associate	1707057, 2447074
Menorrhagia	Associate	10691848
Metabolic Syndrome	Associate	22447087, 34219465
Migraine with Aura	Associate	33795393
Monoclonal Gammopathy of Undetermined Significance	Associate	37822056
Mucocele	Associate	19429776
Multiple Myeloma	Associate	37822056
Multiple Organ Failure	Associate	34137469
Multiple Sclerosis	Associate	23692923, 31675181, 34561786
Multiple Sclerosis	Stimulate	37406976, 39969330
Myasthenia Gravis	Associate	38040826
Myocardial Infarction	Associate	12366606, 12393744, 12406067, 15709716, 17241179, 18772067, 26658659, 32879090, 33228791, 8226773, 9935039
Myocardial Infarction	Stimulate	15670033, 19707286, 20467748
Myocardial Ischemia	Associate	16194201, 2768708
Myopathies Structural Congenital	Associate	11514957
Myotonic Dystrophy	Associate	36507906
Necrosis	Associate	26684871
Neonatal onset citrullinemia type 2	Inhibit	34704407
Neoplasm Metastasis	Associate	23958057, 24294359
Neoplasms	Stimulate	10950840, 31169138
Neoplasms	Associate	1374415, 17949478, 19596924, 2409935, 24294359, 29518939, 30345303, 31393394, 36647888
Neoplasms	Inhibit	8554971
Neoplastic Syndromes Hereditary	Inhibit	29769041
Neoplastic Syndromes Hereditary	Associate	32698516, 8839854
Nervous System Diseases	Associate	19633201, 39988003
Neurodegenerative Diseases	Associate	33142286
Neuroinflammatory Diseases	Associate	33142286, 39209100
Neurologic Manifestations	Associate	39988003
Neutrophil Immunodeficiency Syndrome	Associate	26684871
Non alcoholic Fatty Liver Disease	Associate	26256740
Obesity	Associate	17582472, 21029470, 21959347, 32214403
Obesity	Stimulate	25914268, 30536591, 30658193, 33668851
Obesity Morbid	Stimulate	37266430
Oculocutaneous albinism type 2	Associate	16735602
Osteoarthritis	Associate	39684216
Osteogenesis imperfecta type 1A	Associate	12406067, 33106390
Osteopenic Nonfracture Syndrome	Inhibit	36053959
Osteoporosis	Associate	34977236
Osteoporotic Fractures	Associate	36053959
Osteosarcoma	Associate	23720361
Ovarian Hyperstimulation Syndrome	Associate	28534980
Ovarian Neoplasms	Stimulate	33277847
Pain Postoperative	Associate	29242293
Pancreatic Neoplasms	Associate	17012836
Parkinson Disease	Associate	37939393
Paroxysmal ventricular fibrillation	Associate	27759448
Penile Induration	Associate	447844
Peripheral Arterial Disease	Associate	16443741, 23235487
Persistent Vegetative State	Associate	19698862
Platelet Aggregation Spontaneous	Associate	2932469
Pleural Effusion Malignant	Associate	16899477
Pneumonia	Associate	40611069
Polycystic Ovary Syndrome	Associate	22035022, 28534980
Porencephaly	Associate	2496144
Post Acute COVID 19 Syndrome	Inhibit	37047497
Post Infectious Disorders	Associate	30145561
Pre Eclampsia	Stimulate	22570525
Pre Eclampsia	Associate	28558299
Proteinuria	Associate	18408398
Psoriasis	Associate	20031577
Pulmonary Disease Chronic Obstructive	Stimulate	19272152, 20500811, 25709430
Pulmonary Disease Chronic Obstructive	Associate	22419864, 22701684, 30217946, 33910578, 35534521
Pulmonary Embolism	Associate	10910940, 12871327, 19363122, 19420351, 33128086, 36890726
Purpura Thrombocytopenic Idiopathic	Associate	28409645
Quebec platelet disorder	Inhibit	18791940
Red Cell Aplasia Pure	Associate	29662311
Renal Insufficiency	Associate	24332189
Respiratory Distress Syndrome	Associate	25254322
Respiratory Tract Infections	Associate	31169138
Retinal Perforations	Associate	37530283
Retinal Vein Occlusion	Associate	33270842, 36820679
Salivary Gland Neoplasms	Associate	39201484
Schizophrenia	Associate	24743863
Signs and Symptoms	Associate	23958057
Skin Diseases	Associate	447844
Sleep Apnea Syndromes	Associate	20508215
Smoke Inhalation Injury	Stimulate	21818732
Smoke Inhalation Injury	Associate	24957141
Smoldering Multiple Myeloma	Associate	37822056
ST Elevation Myocardial Infarction	Stimulate	25487289
Stomach Neoplasms	Associate	26662807, 29518939
Stroke	Associate	11260063, 15608011, 21499712, 24090469, 24957141, 37673933, 39988003, 8226773
Syndrome	Associate	10910944
Takayasu Arteritis	Associate	34523592
Tang Hsi Ryu syndrome	Associate	21923924
Tertiary Lymphoid Structures	Stimulate	31169138
Thrombasthenia	Associate	12199799, 12472580, 12941045, 1438206, 1602006, 23995838, 2539213, 40239810, 8049427, 9351872
Thrombocythemia Essential	Stimulate	28397442
Thrombocythemia Essential	Associate	31856623
Thrombocytopenia	Associate	27365488, 34137469
Thrombocytopenia Neonatal Alloimmune	Associate	11830467
Thromboembolism	Associate	15070682
Thromboinflammation	Associate	37390087
Thrombophilia	Associate	1634610, 17650452, 26581183, 37390087, 8473507
Thrombophilia	Stimulate	29308659
Thrombophilia due to Activated Protein C Resistance	Associate	15070682
Thrombophilia hereditary	Associate	1634610
Thrombophlebitis	Associate	40397612
Thrombosis	Associate	10910940, 10911375, 14681238, 15709716, 16881935, 17582472, 18665927, 18700015, 19058807, 19698862, 20031577, 20467748, 24758255, 24759134, 27929198 View all (14 more)
Tibial Meniscus Injuries	Associate	31484330
Tomaculous neuropathy	Associate	13960907
Triglyceride Storage Disease Type I	Stimulate	33760664
Urinary Bladder Neoplasms	Associate	22159600
Vascular Diseases	Associate	20031577, 27929198
Vascular System Injuries	Associate	27929198
Venous Thromboembolism	Associate	10910940, 12752105, 24804362, 26581183, 33367543, 36507737, 37762110
Venous Thromboembolism	Inhibit	33834859
Venous Thrombosis	Associate	10910940, 1634610, 17038160, 17582472, 27812779, 29286337, 29851809, 34142473, 34583575
Venous Thrombosis	Stimulate	20096009
Venous Thrombosis	Inhibit	20156641
Vitamin D Deficiency	Associate	31347309
White Coat Hypertension	Inhibit	25098164
Zinc Deficiency Neonatal due to Low Breast Milk Zinc	Stimulate	37566973

FGB (fibrinogen beta chain)