Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2219
Gene name	Ficolin 1
Gene symbol	FCN1
Synonyms (NCBI Gene)	FCNM
Chromosome	9
Chromosome location	9q34.3
Summary	The ficolin family of proteins are characterized by the presence of a leader peptide, a short N-terminal segment, followed by a collagen-like region, and a C-terminal fibrinogen-like domain. The collagen-like and the fibrinogen-like domains are also found

Show/Hide all (47)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001664	Function	G protein-coupled receptor binding	IPI	21037097
GO:0001867	Process	Complement activation, lectin pathway	IBA
GO:0001867	Process	Complement activation, lectin pathway	IDA	18204047, 22691502, 23386610
GO:0001867	Process	Complement activation, lectin pathway	IDA	16116205
GO:0001905	Process	Activation of membrane attack complex	IDA	18204047
GO:0002376	Process	Immune system process	IEA
GO:0002752	Process	Cell surface pattern recognition receptor signaling pathway	IMP	21037097
GO:0002752	Process	Cell surface pattern recognition receptor signaling pathway	NAS	21037097
GO:0003823	Function	Antigen binding	IBA
GO:0005102	Function	Signaling receptor binding	IBA
GO:0005515	Function	Protein binding	IPI	17581635, 19632990, 21037097, 21490156, 27141819
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005581	Component	Collagen trimer	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	NAS	16116205
GO:0005886	Component	Plasma membrane	IDA	21037097
GO:0005886	Component	Plasma membrane	IEA
GO:0006508	Process	Proteolysis	IDA	16116205
GO:0006956	Process	Complement activation	IDA	26841934, 30111885, 37852260
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	21037097
GO:0008228	Process	Opsonization	IDA	3897448, 8538770
GO:0009897	Component	External side of plasma membrane	NAS	16116205
GO:0016020	Component	Membrane	IEA
GO:0030246	Function	Carbohydrate binding	IEA
GO:0031012	Component	Extracellular matrix	HDA	28344315
GO:0031012	Component	Extracellular matrix	IBA
GO:0031638	Process	Zymogen activation	IDA	22691502, 23386610
GO:0031640	Process	Killing of cells of another organism	IDA	30552328
GO:0032757	Process	Positive regulation of interleukin-8 production	IMP	21037097
GO:0033691	Function	Sialic acid binding	IDA	20032467, 20400674
GO:0033691	Function	Sialic acid binding	IEA
GO:0034394	Process	Protein localization to cell surface	IDA	20400674
GO:0034774	Component	Secretory granule lumen	TAS
GO:0038187	Function	Pattern recognition receptor activity	IDA	20032467, 21037097
GO:0038187	Function	Pattern recognition receptor activity	IMP	21037097
GO:0043654	Process	Recognition of apoptotic cell	IDA	15804047
GO:0045087	Process	Innate immune response	IEA
GO:0046597	Process	Host-mediated suppression of symbiont invasion	IDA	22851708
GO:0046872	Function	Metal ion binding	IEA
GO:0051604	Process	Protein maturation	IDA	6906228, 18204047, 22691502
GO:0097367	Function	Carbohydrate derivative binding	IBA
GO:0097367	Function	Carbohydrate derivative binding	IEA
GO:0106139	Component	Symbiont cell surface	IDA	16116205
GO:1903028	Process	Positive regulation of opsonization	IDA	16116205
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS
GO:1905370	Component	Serine-type endopeptidase complex	IDA	16116205

MIM	HGNC	e!Ensembl
601252	3623	ENSG00000085265

O00602

Protein name

Ficolin-1 (Collagen/fibrinogen domain-containing protein 1) (Ficolin-A) (Ficolin-alpha) (M-ficolin)

Protein function

Extracellular lectin functioning as a pattern-recognition receptor in innate immunity. Binds the sugar moieties of pathogen-associated molecular patterns (PAMPs) displayed on microbes and activates the lectin pathway of the complement system. Ma

PDB

2D39 , 2JHH , 2JHI , 2JHK , 2JHL , 2JHM , 2WNP

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01391	Collagen	50 → 110	Collagen triple helix repeat (20 copies)	Repeat
PF00147	Fibrinogen_C	114 → 326	Fibrinogen beta and gamma chains, C-terminal globular domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Peripheral blood leukocytes, monocytes and granulocytes. Also detected in spleen, lung, and thymus, may be due to the presence of tissue macrophages or trapped blood in these tissues. Not detected on lymphocytes. {ECO:0000269|PubMed:20

Sequence

MELSGATMARGLAVLLVLFLHIKNLPAQAADTCPEVKVVGLEGSDKLTILRGCPGLPGAP
GPKGEAGVIGERGERGLPGAPGKAGPVGPKGDRGEKGMRGEKGDAGQSQSCATGPRNCKD
LLDRGYFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFG
SQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFV
GGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESY
ANGINWSAAKGYKYSYKVSEMKVRPA

Sequence length

326

Interactions

View interactions

	Reactome
			Lectin pathway of complement activation Initial triggering of complement Ficolins bind to repetitive carbohydrate structures on the target cell surface Neutrophil degranulation

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
FCN1-related disorder	Uncertain significance; Likely benign	rs150223979, rs372337686, rs565391562, rs200663920, rs143226419	RCV003397667 RCV003400365 RCV003972002 RCV003932298 RCV003969626
Monoclonal B-Cell Lymphocytosis	Uncertain significance	rs772642922	RCV000208544

Show/Hide Text Mining Associations (31)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Inhibit	39390580
Airway Obstruction	Associate	37996869
Arthritis Rheumatoid	Associate	32820945
Asthma	Stimulate	37996869
Carcinoma Squamous Cell	Inhibit	39390580
Coronary Artery Disease	Associate	31245869
Cross Infection	Associate	32047495
Diabetic Nephropathies	Associate	37492198
Fatigue Syndrome Chronic	Associate	19015737
Fever	Associate	32601370
Hyperlipidemias	Associate	31245869
Infections	Associate	32047495
Inflammatory Bowel Diseases	Stimulate	17453718
Leukemia Myeloid Acute	Associate	29286103
Liver Cirrhosis Biliary	Inhibit	36825008
Lung Neoplasms	Associate	39390580
Lymphoma	Associate	32047495, 32601370
Microscopic Polyangiitis	Stimulate	23944633
MINOCA	Associate	31245869
Mucocutaneous Lymph Node Syndrome	Associate	28900133
Multiple Myeloma	Associate	32047495
Myocardial Infarction	Associate	30886860
Nephrolithiasis Calcium Oxalate	Associate	31694344
Obesity	Associate	37063877
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	32601370
Respiratory Tract Infections	Associate	33591573
Rheumatic Fever	Associate	30619357
Rheumatic Heart Disease	Associate	30619357
ST Elevation Myocardial Infarction	Stimulate	31245869
Status Asthmaticus	Associate	37996869
Tuberculosis Pulmonary	Associate	33591573

FCN1 (ficolin 1)