FCER1A (Fc epsilon receptor Ia)

Gene
Gene Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2205
Gene name Gene Name - the full gene name approved by the HGNC.
Fc epsilon receptor Ia
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FCER1A
Synonyms (NCBI Gene) Gene synonyms aliases
FCE1A, FCERIA, FcERI
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q23.2
Summary Summary of gene provided in NCBI Entrez Gene.
The immunoglobulin epsilon receptor (IgE receptor) is the initiator of the allergic response. When two or more high-affinity IgE receptors are brought together by allergen-bound IgE molecules, mediators such as histamine that are responsible for allergy s
Transcription factors
Gene Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all(9)
Transcription factor Regulation Reference
ELF1 Repression 11971001
GATA1 Activation 11971001
GATA1 Unknown 24639354
GATA2 Activation 24639354
SPI1 Activation 11971001
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all(9)
GO ID Ontology Definition Evidence Reference
GO:0004888 Function Transmembrane signaling receptor activity IBA 21873635
GO:0005515 Function Protein binding IPI 32296183
GO:0005886 Component Plasma membrane TAS
GO:0005887 Component Integral component of plasma membrane IBA 21873635
GO:0007166 Process Cell surface receptor signaling pathway IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene Transcription factors Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
147140 3609 ENSG00000179639
Protein
Gene Transcription factors Gene ontology Other IDs Protein Pathways
UniProt ID P12319
Protein name High affinity immunoglobulin epsilon receptor subunit alpha (Fc-epsilon RI-alpha) (FcERI) (IgE Fc receptor subunit alpha)
Protein function High-affinity receptor for immunoglobulin epsilon/IgE. Mediates IgE effector functions in myeloid cells. Upon IgE binding and antigen/allergen cross-linking initiates signaling pathways that lead to myeloid cell activation and differentiation. O
PDB 1F2Q , 1F6A , 1J86 , 1J87 , 1J88 , 1J89 , 1RPQ , 2Y7Q , 7SHT , 8C1B , 8C1C , 8K7R , 8YVU , 8YWA , 8Z0T , 9EQ3 , 9EQ4
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13927 Ig_3 29 → 96 Domain
PF13895 Ig_2 112 → 194 Immunoglobulin domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in eosinophils. {ECO:0000269|PubMed:8114916}.
Sequence 
MAPAMESPTLLCVALLFFAPDGVLAVPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVS
STKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAE
VVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKV
WQLDYESEPLNITVIKAPREKYWLQFFIPLLVVILFAVDTGLFISTQQQVTFLLKIKRTR
KGFRLLNPHPKPNPKNN
Sequence length 257
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene Transcription factors Gene ontology Other IDs Protein Pathways
  KEGG   Reactome
  Sphingolipid signaling pathway
Phospholipase D signaling pathway
Fc epsilon RI signaling pathway
Asthma 		  Fc epsilon receptor (FCERI) signaling
Role of LAT2/NTAL/LAB on calcium mobilization
FCERI mediated MAPK activation
FCERI mediated Ca+2 mobilization
FCERI mediated NF-kB activation