Gene Gene information from NCBI Gene database.
Entrez ID 220164
Gene name Docking protein 6
Gene symbol DOK6
Synonyms (NCBI Gene)
DOK5LHsT3226
Chromosome 18
Chromosome location 18q22.2
Summary DOK6 is a member of the DOK (see DOK1; MIM 602919) family of intracellular adaptors that play a role in the RET (MIM 164761) signaling cascade (Crowder et al., 2004 [PubMed 15286081]).[supplied by OMIM, Mar 2008]
miRNA miRNA information provided by mirtarbase database.
242
miRTarBase ID miRNA Experiments Reference
MIRT018286 hsa-miR-335-5p Microarray 18185580
MIRT023914 hsa-miR-1-3p Microarray 18668037
MIRT721835 hsa-miR-410-3p HITS-CLIP 19536157
MIRT721834 hsa-miR-5011-5p HITS-CLIP 19536157
MIRT721833 hsa-miR-141-5p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 16273093, 20565848, 25416956, 32296183
GO:0005737 Component Cytoplasm IBA
GO:0005829 Component Cytosol TAS
GO:0007169 Process Cell surface receptor protein tyrosine kinase signaling pathway IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
611402 28301 ENSG00000206052
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6PKX4
Protein name Docking protein 6 (Downstream of tyrosine kinase 6)
Protein function DOK proteins are enzymatically inert adaptor or scaffolding proteins. They provide a docking platform for the assembly of multimolecular signaling complexes. DOK6 promotes Ret-mediated neurite growth. May have a role in brain development and/or
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02174 IRS 135 232 PTB domain (IRS-1 type) Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in fetal and adult brain. Highly expressed in the cerebellum. Weak expression in kidney, spinal cord and testis. {ECO:0000269|PubMed:15286081}.
Sequence
MASNFNDIVKQGYVKIRSRKLGIFRRCWLVFKKASSKGPRRLEKFPDEKAAYFRNFHKVT
ELHNIKNITRLPRETKKHAVAIIFHDETSKTFACESELEAEEWCKHLCMECLGTRLNDIS
LGEPDLLAAGVQREQNERFNVYLMPTPNLDIYGECTMQITHENIYLWDIHNAKVKLVMWP
LSSLRRYGRDSTWFTFESGRMCDTGEGLFTFQTREGEMIYQKVHSATLAIAE
QHERLMLE
MEQKARLQTSLTEPMTLSKSISLPRSAYWHHITRQNSVGEIYSLQGHGFGSSKMSRAQTF
PSYAPEQSEEAQQPLSRSSSYGFSYSSSLIQ
Sequence length 331
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    RET signaling