Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	219931
Gene name	Two pore segment channel 2
Gene symbol	TPCN2
Synonyms (NCBI Gene)	SHEP10TPC2
Chromosome	11
Chromosome location	11q13.3
Summary	This gene encodes a putative cation-selective ion channel with two repeats of a six-transmembrane-domain. The protein localizes to lysosomal membranes and enables nicotinic acid adenine dinucleotide phosphate (NAADP) -induced calcium ion release from lyso

287

Show/Hide all (287)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022968	hsa-miR-124-3p	Microarray	18668037
MIRT719062	hsa-miR-377-5p	HITS-CLIP	19536157
MIRT719061	hsa-miR-6086	HITS-CLIP	19536157
MIRT711260	hsa-miR-3689a-5p	HITS-CLIP	19536157
MIRT711259	hsa-miR-3689b-5p	HITS-CLIP	19536157
MIRT711258	hsa-miR-3689e	HITS-CLIP	19536157
MIRT711257	hsa-miR-3689f	HITS-CLIP	19536157
MIRT711256	hsa-miR-3161	HITS-CLIP	19536157
MIRT711255	hsa-miR-8070	HITS-CLIP	19536157
MIRT719062	hsa-miR-377-5p	HITS-CLIP	19536157
MIRT719061	hsa-miR-6086	HITS-CLIP	19536157
MIRT711260	hsa-miR-3689a-5p	HITS-CLIP	19536157
MIRT711259	hsa-miR-3689b-5p	HITS-CLIP	19536157
MIRT711258	hsa-miR-3689e	HITS-CLIP	19536157
MIRT711257	hsa-miR-3689f	HITS-CLIP	19536157
MIRT711256	hsa-miR-3161	HITS-CLIP	19536157
MIRT711255	hsa-miR-8070	HITS-CLIP	19536157
MIRT714663	hsa-miR-3529-3p	HITS-CLIP	19536157
MIRT714662	hsa-miR-603	HITS-CLIP	19536157
MIRT714661	hsa-miR-549a	HITS-CLIP	19536157
MIRT714660	hsa-miR-4504	HITS-CLIP	19536157
MIRT714659	hsa-miR-3692-3p	HITS-CLIP	19536157
MIRT711260	hsa-miR-3689a-5p	HITS-CLIP	19536157
MIRT711259	hsa-miR-3689b-5p	HITS-CLIP	19536157
MIRT711258	hsa-miR-3689e	HITS-CLIP	19536157
MIRT711257	hsa-miR-3689f	HITS-CLIP	19536157
MIRT711256	hsa-miR-3161	HITS-CLIP	19536157
MIRT711255	hsa-miR-8070	HITS-CLIP	19536157
MIRT711260	hsa-miR-3689a-5p	HITS-CLIP	19536157
MIRT711259	hsa-miR-3689b-5p	HITS-CLIP	19536157
MIRT711258	hsa-miR-3689e	HITS-CLIP	19536157
MIRT711257	hsa-miR-3689f	HITS-CLIP	19536157
MIRT711256	hsa-miR-3161	HITS-CLIP	19536157
MIRT711255	hsa-miR-8070	HITS-CLIP	19536157
MIRT664480	hsa-miR-122-3p	HITS-CLIP	23824327
MIRT648611	hsa-miR-1247-3p	HITS-CLIP	23824327
MIRT648610	hsa-miR-4532	HITS-CLIP	23824327
MIRT675446	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT675445	hsa-miR-1976	HITS-CLIP	23824327
MIRT648605	hsa-miR-2276-3p	HITS-CLIP	23824327
MIRT675444	hsa-miR-4279	HITS-CLIP	23824327
MIRT664480	hsa-miR-122-3p	HITS-CLIP	23824327
MIRT648613	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT648611	hsa-miR-1247-3p	HITS-CLIP	23824327
MIRT648610	hsa-miR-4532	HITS-CLIP	23824327
MIRT648609	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT648608	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT648607	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT648606	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT648605	hsa-miR-2276-3p	HITS-CLIP	23824327
MIRT648604	hsa-miR-4284	HITS-CLIP	23824327
MIRT648613	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT648611	hsa-miR-1247-3p	HITS-CLIP	23824327
MIRT648610	hsa-miR-4532	HITS-CLIP	23824327
MIRT648609	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT648608	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT648607	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT648606	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT648605	hsa-miR-2276-3p	HITS-CLIP	23824327
MIRT648604	hsa-miR-4284	HITS-CLIP	23824327
MIRT571334	hsa-miR-6871-5p	PAR-CLIP	20371350
MIRT571333	hsa-miR-485-5p	PAR-CLIP	20371350
MIRT571332	hsa-miR-6884-5p	PAR-CLIP	20371350
MIRT571330	hsa-miR-4481	PAR-CLIP	20371350
MIRT571331	hsa-miR-4745-5p	PAR-CLIP	20371350
MIRT571329	hsa-miR-34a-5p	PAR-CLIP	20371350
MIRT571328	hsa-miR-34c-5p	PAR-CLIP	20371350
MIRT571327	hsa-miR-449a	PAR-CLIP	20371350
MIRT571326	hsa-miR-449b-5p	PAR-CLIP	20371350
MIRT571325	hsa-miR-548au-3p	PAR-CLIP	20371350
MIRT571324	hsa-miR-7106-5p	PAR-CLIP	20371350
MIRT571323	hsa-miR-149-3p	PAR-CLIP	20371350
MIRT571322	hsa-miR-4728-5p	PAR-CLIP	20371350
MIRT571321	hsa-miR-6785-5p	PAR-CLIP	20371350
MIRT571320	hsa-miR-6883-5p	PAR-CLIP	20371350
MIRT571319	hsa-miR-6799-5p	PAR-CLIP	20371350
MIRT571318	hsa-miR-363-5p	PAR-CLIP	20371350
MIRT571317	hsa-miR-6745	PAR-CLIP	20371350
MIRT571315	hsa-miR-6756-5p	PAR-CLIP	20371350
MIRT571316	hsa-miR-6766-5p	PAR-CLIP	20371350
MIRT571314	hsa-miR-1293	PAR-CLIP	20371350
MIRT571313	hsa-miR-4483	PAR-CLIP	20371350
MIRT571312	hsa-miR-6748-5p	PAR-CLIP	20371350
MIRT571311	hsa-miR-1273h-5p	PAR-CLIP	20371350
MIRT571310	hsa-miR-30b-3p	PAR-CLIP	20371350
MIRT571309	hsa-miR-3689a-3p	PAR-CLIP	20371350
MIRT571308	hsa-miR-3689b-3p	PAR-CLIP	20371350
MIRT571307	hsa-miR-3689c	PAR-CLIP	20371350
MIRT571306	hsa-miR-6779-5p	PAR-CLIP	20371350
MIRT571305	hsa-miR-6780a-5p	PAR-CLIP	20371350
MIRT571304	hsa-miR-6127	PAR-CLIP	20371350
MIRT447287	hsa-miR-3163	PAR-CLIP	22100165
MIRT719062	hsa-miR-377-5p	HITS-CLIP	19536157
MIRT719061	hsa-miR-6086	HITS-CLIP	19536157
MIRT711260	hsa-miR-3689a-5p	HITS-CLIP	19536157
MIRT711259	hsa-miR-3689b-5p	HITS-CLIP	19536157
MIRT711258	hsa-miR-3689e	HITS-CLIP	19536157
MIRT711257	hsa-miR-3689f	HITS-CLIP	19536157
MIRT711256	hsa-miR-3161	HITS-CLIP	19536157
MIRT711255	hsa-miR-8070	HITS-CLIP	19536157
MIRT719062	hsa-miR-377-5p	HITS-CLIP	19536157
MIRT719061	hsa-miR-6086	HITS-CLIP	19536157
MIRT711260	hsa-miR-3689a-5p	HITS-CLIP	19536157
MIRT711259	hsa-miR-3689b-5p	HITS-CLIP	19536157
MIRT711258	hsa-miR-3689e	HITS-CLIP	19536157
MIRT711257	hsa-miR-3689f	HITS-CLIP	19536157
MIRT711256	hsa-miR-3161	HITS-CLIP	19536157
MIRT711255	hsa-miR-8070	HITS-CLIP	19536157
MIRT714663	hsa-miR-3529-3p	HITS-CLIP	19536157
MIRT714662	hsa-miR-603	HITS-CLIP	19536157
MIRT714661	hsa-miR-549a	HITS-CLIP	19536157
MIRT714660	hsa-miR-4504	HITS-CLIP	19536157
MIRT714659	hsa-miR-3692-3p	HITS-CLIP	19536157
MIRT711260	hsa-miR-3689a-5p	HITS-CLIP	19536157
MIRT711259	hsa-miR-3689b-5p	HITS-CLIP	19536157
MIRT711258	hsa-miR-3689e	HITS-CLIP	19536157
MIRT711257	hsa-miR-3689f	HITS-CLIP	19536157
MIRT711256	hsa-miR-3161	HITS-CLIP	19536157
MIRT711255	hsa-miR-8070	HITS-CLIP	19536157
MIRT711260	hsa-miR-3689a-5p	HITS-CLIP	19536157
MIRT711259	hsa-miR-3689b-5p	HITS-CLIP	19536157
MIRT711258	hsa-miR-3689e	HITS-CLIP	19536157
MIRT711257	hsa-miR-3689f	HITS-CLIP	19536157
MIRT711256	hsa-miR-3161	HITS-CLIP	19536157
MIRT711255	hsa-miR-8070	HITS-CLIP	19536157
MIRT664480	hsa-miR-122-3p	HITS-CLIP	23824327
MIRT648611	hsa-miR-1247-3p	HITS-CLIP	23824327
MIRT648610	hsa-miR-4532	HITS-CLIP	23824327
MIRT675446	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT675445	hsa-miR-1976	HITS-CLIP	23824327
MIRT648605	hsa-miR-2276-3p	HITS-CLIP	23824327
MIRT675444	hsa-miR-4279	HITS-CLIP	23824327
MIRT664480	hsa-miR-122-3p	HITS-CLIP	23824327
MIRT648613	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT648611	hsa-miR-1247-3p	HITS-CLIP	23824327
MIRT648610	hsa-miR-4532	HITS-CLIP	23824327
MIRT648609	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT648608	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT648607	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT648606	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT648605	hsa-miR-2276-3p	HITS-CLIP	23824327
MIRT648604	hsa-miR-4284	HITS-CLIP	23824327
MIRT648613	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT648611	hsa-miR-1247-3p	HITS-CLIP	23824327
MIRT648610	hsa-miR-4532	HITS-CLIP	23824327
MIRT648609	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT648608	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT648607	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT648606	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT648605	hsa-miR-2276-3p	HITS-CLIP	23824327
MIRT648604	hsa-miR-4284	HITS-CLIP	23824327
MIRT571334	hsa-miR-6871-5p	PAR-CLIP	20371350
MIRT571333	hsa-miR-485-5p	PAR-CLIP	20371350
MIRT571332	hsa-miR-6884-5p	PAR-CLIP	20371350
MIRT571330	hsa-miR-4481	PAR-CLIP	20371350
MIRT571331	hsa-miR-4745-5p	PAR-CLIP	20371350
MIRT571329	hsa-miR-34a-5p	PAR-CLIP	20371350
MIRT571328	hsa-miR-34c-5p	PAR-CLIP	20371350
MIRT571327	hsa-miR-449a	PAR-CLIP	20371350
MIRT571326	hsa-miR-449b-5p	PAR-CLIP	20371350
MIRT571325	hsa-miR-548au-3p	PAR-CLIP	20371350
MIRT571324	hsa-miR-7106-5p	PAR-CLIP	20371350
MIRT571323	hsa-miR-149-3p	PAR-CLIP	20371350
MIRT571322	hsa-miR-4728-5p	PAR-CLIP	20371350
MIRT571321	hsa-miR-6785-5p	PAR-CLIP	20371350
MIRT571320	hsa-miR-6883-5p	PAR-CLIP	20371350
MIRT571319	hsa-miR-6799-5p	PAR-CLIP	20371350
MIRT571318	hsa-miR-363-5p	PAR-CLIP	20371350
MIRT571317	hsa-miR-6745	PAR-CLIP	20371350
MIRT571315	hsa-miR-6756-5p	PAR-CLIP	20371350
MIRT571316	hsa-miR-6766-5p	PAR-CLIP	20371350
MIRT571314	hsa-miR-1293	PAR-CLIP	20371350
MIRT571313	hsa-miR-4483	PAR-CLIP	20371350
MIRT571312	hsa-miR-6748-5p	PAR-CLIP	20371350
MIRT571311	hsa-miR-1273h-5p	PAR-CLIP	20371350
MIRT571310	hsa-miR-30b-3p	PAR-CLIP	20371350
MIRT571309	hsa-miR-3689a-3p	PAR-CLIP	20371350
MIRT571308	hsa-miR-3689b-3p	PAR-CLIP	20371350
MIRT571307	hsa-miR-3689c	PAR-CLIP	20371350
MIRT571306	hsa-miR-6779-5p	PAR-CLIP	20371350
MIRT571305	hsa-miR-6780a-5p	PAR-CLIP	20371350
MIRT571304	hsa-miR-6127	PAR-CLIP	20371350
MIRT447287	hsa-miR-3163	PAR-CLIP	22100165
MIRT1449008	hsa-miR-1226	CLIP-seq
MIRT1449009	hsa-miR-1229	CLIP-seq
MIRT1449010	hsa-miR-125a-5p	CLIP-seq
MIRT1449011	hsa-miR-125b	CLIP-seq
MIRT1449012	hsa-miR-1279	CLIP-seq
MIRT1449013	hsa-miR-1281	CLIP-seq
MIRT1449014	hsa-miR-1291	CLIP-seq
MIRT1449015	hsa-miR-19a	CLIP-seq
MIRT1449016	hsa-miR-19b	CLIP-seq
MIRT1449017	hsa-miR-29a	CLIP-seq
MIRT1449018	hsa-miR-29b	CLIP-seq
MIRT1449019	hsa-miR-29c	CLIP-seq
MIRT1449020	hsa-miR-3137	CLIP-seq
MIRT1449021	hsa-miR-3177-3p	CLIP-seq
MIRT1449022	hsa-miR-34a	CLIP-seq
MIRT1449023	hsa-miR-361-3p	CLIP-seq
MIRT1449024	hsa-miR-3616-3p	CLIP-seq
MIRT1449025	hsa-miR-3660	CLIP-seq
MIRT1449026	hsa-miR-3686	CLIP-seq
MIRT1449027	hsa-miR-4272	CLIP-seq
MIRT1449028	hsa-miR-4311	CLIP-seq
MIRT1449029	hsa-miR-4313	CLIP-seq
MIRT1449030	hsa-miR-4319	CLIP-seq
MIRT1449031	hsa-miR-4420	CLIP-seq
MIRT1449032	hsa-miR-449b	CLIP-seq
MIRT1449033	hsa-miR-4526	CLIP-seq
MIRT1449034	hsa-miR-4530	CLIP-seq
MIRT1449035	hsa-miR-455-5p	CLIP-seq
MIRT1449036	hsa-miR-4645-3p	CLIP-seq
MIRT1449037	hsa-miR-4732-3p	CLIP-seq
MIRT1449038	hsa-miR-4795-3p	CLIP-seq
MIRT1449039	hsa-miR-548a-3p	CLIP-seq
MIRT1449040	hsa-miR-548ae	CLIP-seq
MIRT1449041	hsa-miR-548aj	CLIP-seq
MIRT1449042	hsa-miR-548am	CLIP-seq
MIRT1449043	hsa-miR-548e	CLIP-seq
MIRT1449044	hsa-miR-548f	CLIP-seq
MIRT1449045	hsa-miR-548x	CLIP-seq
MIRT1449046	hsa-miR-549	CLIP-seq
MIRT1449047	hsa-miR-564	CLIP-seq
MIRT1449048	hsa-miR-566	CLIP-seq
MIRT1449049	hsa-miR-587	CLIP-seq
MIRT1449050	hsa-miR-634	CLIP-seq
MIRT1449051	hsa-miR-646	CLIP-seq
MIRT1449052	hsa-miR-658	CLIP-seq
MIRT1449053	hsa-miR-670	CLIP-seq
MIRT1449054	hsa-miR-938	CLIP-seq
MIRT1555136	hsa-miR-3150a-3p	CLIP-seq
MIRT1555137	hsa-miR-3175	CLIP-seq
MIRT1555138	hsa-miR-939	CLIP-seq
MIRT2134334	hsa-miR-1286	CLIP-seq
MIRT2134335	hsa-miR-137	CLIP-seq
MIRT2134336	hsa-miR-3145-5p	CLIP-seq
MIRT2134337	hsa-miR-3647-3p	CLIP-seq
MIRT2134338	hsa-miR-3919	CLIP-seq
MIRT2134339	hsa-miR-450b-5p	CLIP-seq
MIRT2134340	hsa-miR-4759	CLIP-seq
MIRT2134341	hsa-miR-508-5p	CLIP-seq
MIRT2134342	hsa-miR-520a-5p	CLIP-seq
MIRT2134343	hsa-miR-525-5p	CLIP-seq
MIRT2355556	hsa-miR-1224-3p	CLIP-seq
MIRT1449008	hsa-miR-1226	CLIP-seq
MIRT2134334	hsa-miR-1286	CLIP-seq
MIRT2355557	hsa-miR-140-3p	CLIP-seq
MIRT2355558	hsa-miR-300	CLIP-seq
MIRT2355559	hsa-miR-3140-5p	CLIP-seq
MIRT2134336	hsa-miR-3145-5p	CLIP-seq
MIRT2355560	hsa-miR-3154	CLIP-seq
MIRT2355561	hsa-miR-324-5p	CLIP-seq
MIRT2355562	hsa-miR-338-3p	CLIP-seq
MIRT1449022	hsa-miR-34a	CLIP-seq
MIRT2355563	hsa-miR-3622a-3p	CLIP-seq
MIRT2355564	hsa-miR-3622b-3p	CLIP-seq
MIRT2355565	hsa-miR-365	CLIP-seq
MIRT2355566	hsa-miR-381	CLIP-seq
MIRT2134338	hsa-miR-3919	CLIP-seq
MIRT2355567	hsa-miR-3978	CLIP-seq
MIRT2355568	hsa-miR-4286	CLIP-seq
MIRT1449028	hsa-miR-4311	CLIP-seq
MIRT2355569	hsa-miR-4421	CLIP-seq
MIRT2355570	hsa-miR-4427	CLIP-seq
MIRT2355571	hsa-miR-4457	CLIP-seq
MIRT2355572	hsa-miR-4475	CLIP-seq
MIRT1449032	hsa-miR-449b	CLIP-seq
MIRT2355573	hsa-miR-4661-3p	CLIP-seq
MIRT2134340	hsa-miR-4759	CLIP-seq
MIRT2134341	hsa-miR-508-5p	CLIP-seq
MIRT2134342	hsa-miR-520a-5p	CLIP-seq
MIRT2134343	hsa-miR-525-5p	CLIP-seq
MIRT2355574	hsa-miR-552	CLIP-seq
MIRT1449050	hsa-miR-634	CLIP-seq
MIRT2355575	hsa-miR-659	CLIP-seq
MIRT2396242	hsa-miR-1257	CLIP-seq
MIRT2134334	hsa-miR-1286	CLIP-seq
MIRT2396243	hsa-miR-490-3p	CLIP-seq
MIRT2396244	hsa-miR-649	CLIP-seq
MIRT2355556	hsa-miR-1224-3p	CLIP-seq
MIRT1449008	hsa-miR-1226	CLIP-seq
MIRT2355561	hsa-miR-324-5p	CLIP-seq
MIRT2355562	hsa-miR-338-3p	CLIP-seq
MIRT2355563	hsa-miR-3622a-3p	CLIP-seq
MIRT2355564	hsa-miR-3622b-3p	CLIP-seq
MIRT2355568	hsa-miR-4286	CLIP-seq
MIRT1449050	hsa-miR-634	CLIP-seq

Show/Hide all (64)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005216	Function	Monoatomic ion channel activity	IEA
GO:0005245	Function	Voltage-gated calcium channel activity	IDA	23063126
GO:0005245	Function	Voltage-gated calcium channel activity	ISS
GO:0005248	Function	Voltage-gated sodium channel activity	IDA	24776928
GO:0005262	Function	Calcium channel activity	IDA	27140606
GO:0005262	Function	Calcium channel activity	IEA
GO:0005515	Function	Protein binding	IPI	21903581, 23394946, 24188827
GO:0005764	Component	Lysosome	IDA	22012985
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IBA
GO:0005765	Component	Lysosomal membrane	IDA	19387438, 19620632, 20880839, 23063126
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005765	Component	Lysosomal membrane	TAS
GO:0005768	Component	Endosome	IEA
GO:0005829	Component	Cytosol	IEA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006816	Process	Calcium ion transport	IEA
GO:0006874	Process	Intracellular calcium ion homeostasis	IDA	19387438
GO:0006939	Process	Smooth muscle contraction	IEA
GO:0006939	Process	Smooth muscle contraction	ISS
GO:0007040	Process	Lysosome organization	IGI	25416817
GO:0010008	Component	Endosome membrane	IDA	19620632
GO:0010506	Process	Regulation of autophagy	IGI	22012985
GO:0015280	Function	Ligand-gated sodium channel activity	IBA
GO:0015280	Function	Ligand-gated sodium channel activity	IDA	23063126, 30860481, 32167471
GO:0015280	Function	Ligand-gated sodium channel activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0017157	Process	Regulation of exocytosis	IEA
GO:0017157	Process	Regulation of exocytosis	ISS
GO:0019065	Process	Receptor-mediated endocytosis of virus by host cell	IDA	32221306
GO:0019722	Process	Calcium-mediated signaling	IBA
GO:0019722	Process	Calcium-mediated signaling	IEA
GO:0019722	Process	Calcium-mediated signaling	IGI	25416817
GO:0019901	Function	Protein kinase binding	IPI	22012985
GO:0022832	Function	Voltage-gated channel activity	IEA
GO:0031902	Component	Late endosome membrane	IEA
GO:0033162	Component	Melanosome membrane	IDA	27140606
GO:0033162	Component	Melanosome membrane	IEA
GO:0033280	Process	Response to vitamin D	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	TAS
GO:0034702	Component	Monoatomic ion channel complex	IEA
GO:0035725	Process	Sodium ion transmembrane transport	IDA	30860481
GO:0036020	Component	Endolysosome membrane	IDA	32167471
GO:0042802	Function	Identical protein binding	IDA	30860481
GO:0042802	Function	Identical protein binding	IPI	21903581
GO:0048086	Process	Negative regulation of developmental pigmentation	IDA	27140606
GO:0048086	Process	Negative regulation of developmental pigmentation	IEA
GO:0051209	Process	Release of sequestered calcium ion into cytosol	IEA
GO:0051452	Process	Intracellular pH reduction	IDA	27140606
GO:0051452	Process	Intracellular pH reduction	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0070588	Process	Calcium ion transmembrane transport	IEA
GO:0072345	Function	NAADP-sensitive calcium-release channel activity	IDA	23063126
GO:0072345	Function	NAADP-sensitive calcium-release channel activity	IDA	19387438, 19620632, 20880839, 32167471
GO:0072345	Function	NAADP-sensitive calcium-release channel activity	TAS
GO:0075509	Process	Endocytosis involved in viral entry into host cell	IBA
GO:0075509	Process	Endocytosis involved in viral entry into host cell	IEA
GO:0075509	Process	Endocytosis involved in viral entry into host cell	IMP	25722412
GO:0080025	Function	Phosphatidylinositol-3,5-bisphosphate binding	IDA	23063126, 30860481
GO:0090117	Process	Endosome to lysosome transport of low-density lipoprotein particle	IEA
GO:0090117	Process	Endosome to lysosome transport of low-density lipoprotein particle	ISS
GO:0097682	Function	Intracellularly phosphatidylinositol-3,5-bisphosphate-gated monatomic cation channel activity	IBA
GO:0097682	Function	Intracellularly phosphatidylinositol-3,5-bisphosphate-gated monatomic cation channel activity	IDA	23063126, 30860481, 32167471

MIM	HGNC	e!Ensembl
612163	20820	ENSG00000162341

Q8NHX9

Protein name

Two pore channel protein 2 (Two pore calcium channel protein 2)

Protein function

Intracellular channel initially characterized as a non-selective Ca(2+)-permeable channel activated by NAADP (nicotinic acid adenine dinucleotide phosphate), it is also a highly-selective Na(+) channel activated directly by PI(3,5)P2 (phosphatid

PDB

6NQ0 , 6NQ1 , 6NQ2 , 8OUO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00520	Ion_trans	84 → 318	Ion transport protein	Family
PF00520	Ion_trans	431 → 699	Ion transport protein	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Expressed at high level in liver and kidney. {ECO:0000269|PubMed:19387438}.

Sequence

MAEPQAESEPLLGGARGGGGDWPAGLTTYRSIQVGPGAAARWDLCIDQAVVFIEDAIQYR
SINHRVDASSMWLYRRYYSNVCQRTLSFTIFLILFLAFIETPSSLTSTADVRYRAAPWEP
PCGLTESVEVLCLLVFAADLSVKGYLFGWAHFQKNLWLLGYLVVLVVSLVDWTVSLSLVC
HEPLRIRRLLRPFFLLQNSSMMKKTLKCIRWSLPEMASVGLLLAIHLCLFTMFGMLLFAG
GKQDDGQDRERLTYFQNLPESLTSLLVLLTTANNPDVMIPAYSKNRAYAIFFIVFTVIGS
LFLMNLLTAIIYSQFRGYLMKSLQTSLFRRRLGTRAAFEVLSSMVGEGGAFPQAVGVKPQ
NLLQVLQKVQLDSSHKQAMMEKVRSYGSVLLSAEEFQKLFNELDRSVVKEHPPRPEYQSP
FLQSAQFLFGHYYFDYLGNLIALANLVSICVFLVLDADVLPAERDDFILGILNCVFIVYY
LLEMLLKVFALGLRGYLSYPSNVFDGLLTVVLLVLEISTLAVYRLPHPGWRPEMVGLLSL
WDMTRMLNMLIVFRFLRIIPSMKLMAVVASTVLGLVQNMRAFGGILVVVYYVFAIIGINL
FRGVIVALPGNSSLAPANGSAPCGSFEQLEYWANNFDDFAAALVTLWNLMVVNNWQVFLD
AYRRYSGPWSKIYFVLWWLVSSVIWVNLFLALILENFLHKWDPRSHLQPLAGTPEATYQM
TVELLFRDILEEPGEDELTERLSQHPHLWLCR

Sequence length

752

Interactions

View interactions

	KEGG		Reactome
	Calcium signaling pathway Pancreatic secretion		Stimuli-sensing channels

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (23)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALBINISM	—	GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BASAL CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE FRACTURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS MELANOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLOMERULONEPHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Marfanoid habitus and intellectual disability	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN/HAIR/EYE PIGMENTATION, VARIATION IN, 10	Uncertain significance; association	ClinVar HPO	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (15)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Albinism	Associate	38279271	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bicuspid Aortic Valve Disease	Associate	36071494	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Associate	36496446	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Associate	36496446	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Associate	26918892	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Associate	26918892	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Stimulate	22701570	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infections	Associate	36314791	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Associate	35194006	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lysosomal Storage Diseases	Associate	35915060	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	33875769, 35181301	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	36496446	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Associate	25416817	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pigmentation Disorders	Associate	25789475, 35181301, 36496446	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	35915060	★★★★★ ★☆☆☆☆ Found in Text Mining only

TPCN2 (two pore segment channel 2)