Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	218
Gene name Gene Name - the full gene name approved by the HGNC.	Aldehyde dehydrogenase 3 family member A1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ALDH3A1
Synonyms (NCBI Gene) Gene synonyms aliases	ALDH3, ALDHIII
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17p11.2
Summary Summary of gene provided in NCBI Entrez Gene.	Aldehyde dehydrogenases oxidize various aldehydes to the corresponding acids. They are involved in the detoxification of alcohol-derived acetaldehyde and in the metabolism of corticosteroids, biogenic amines, neurotransmitters, and lipid peroxidation. The

Show/Hide all(2)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021523	hsa-miR-145-5p	Reporter assay;Microarray	21351259
MIRT737993	hsa-miR-150	HITS-CLIP	33718276

Show/Hide all(26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004028	Function	3-chloroallyl aldehyde dehydrogenase activity	IBA
GO:0004028	Function	3-chloroallyl aldehyde dehydrogenase activity	IEA
GO:0004029	Function	Aldehyde dehydrogenase (NAD+) activity	IBA
GO:0004029	Function	Aldehyde dehydrogenase (NAD+) activity	IDA	1737758
GO:0004029	Function	Aldehyde dehydrogenase (NAD+) activity	IEA
GO:0004030	Function	Aldehyde dehydrogenase [NAD(P)+] activity	IEA
GO:0004030	Function	Aldehyde dehydrogenase [NAD(P)+] activity	TAS
GO:0005515	Function	Protein binding	IPI	21044950, 32296183
GO:0005615	Component	Extracellular space	HDA	22664934
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	ISS
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0006081	Process	Aldehyde metabolic process	IBA
GO:0006081	Process	Aldehyde metabolic process	IDA	1737758
GO:0006081	Process	Aldehyde metabolic process	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006805	Process	Xenobiotic metabolic process	TAS
GO:0008106	Function	Alcohol dehydrogenase (NADP+) activity	IDA	1737758
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016620	Function	Oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor	IEA
GO:0018479	Function	Benzaldehyde dehydrogenase (NAD+) activity	IDA	4015840

MIM	HGNC	e!Ensembl
100660	405	ENSG00000108602

Protein

UniProt ID

P30838

Protein name

Aldehyde dehydrogenase, dimeric NADP-preferring (EC 1.2.1.5) (ALDHIII) (Aldehyde dehydrogenase 3) (Aldehyde dehydrogenase family 3 member A1)

Protein function

ALDHs play a major role in the detoxification of alcohol-derived acetaldehyde (Probable). They are involved in the metabolism of corticosteroids, biogenic amines, neurotransmitters, and lipid peroxidation (Probable). Oxidizes medium and long cha

PDB

3SZA , 3SZB , 4H80 , 4L1O , 4L2O , 8BB8

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00171	Aldedh	1 → 428	Aldehyde dehydrogenase family	Family

Tissue specificity

TISSUE SPECIFICITY: High levels in stomach, esophagus and lung; low level in the liver and kidney.

Sequence

MSKISEAVKRARAAFSSGRTRPLQFRIQQLEALQRLIQEQEQELVGALAADLHKNEWNAY
YEEVVYVLEEIEYMIQKLPEWAADEPVEKTPQTQQDELYIHSEPLGVVLVIGTWNYPFNL
TIQPMVGAIAAGNSVVLKPSELSENMASLLATIIPQYLDKDLYPVINGGVPETTELLKER
FDHILYTGSTGVGKIIMTAAAKHLTPVTLELGGKSPCYVDKNCDLDVACRRIAWGKFMNS
GQTCVAPDYILCDPSIQNQIVEKLKKSLKEFYGEDAKKSRDYGRIISARHFQRVMGLIEG
QKVAYGGTGDAATRYIAPTILTDVDPQSPVMQEEIFGPVLPIVCVRSLEEAIQFINQREK
PLALYMFSSNDKVIKKMIAETSSGGVAANDVIVHITLHSLPFGGVGNSGMGSYHGKKSFE
TFSHRRSCLVRPLMNDEGLKVRYPPSPAKMTQH

Sequence length

453

Interactions

View interactions

	KEGG		Reactome
	Glycolysis / Gluconeogenesis Histidine metabolism Tyrosine metabolism Phenylalanine metabolism beta-Alanine metabolism Metabolism of xenobiotics by cytochrome P450 Drug metabolism - cytochrome P450 Metabolic pathways		Phase I - Functionalization of compounds

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Keratoconus	Keratoconus	N/A	N/A	GWAS

Show/Hide Text Mining Associations (29)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	24387105, 24677340, 32064933
Breast Neoplasms	Associate	20102361
Carcinoma Non Small Cell Lung	Associate	19025616, 37730658
Carcinoma Squamous Cell	Associate	24019906
Chronic Disease	Associate	35163684
Colorectal Neoplasms	Associate	37535601
Diabetic Retinopathy	Associate	32993645
DNA Virus Infections	Associate	30065307
Drug Related Side Effects and Adverse Reactions	Inhibit	24316006
Drug Related Side Effects and Adverse Reactions	Associate	24677340, 35163684
Dry Eye Syndromes	Associate	27436115
Fetal Growth Retardation	Associate	31138432
Glioblastoma	Associate	24387105, 24677340
Haspeslagh Fryns Muelenaere syndrome	Associate	25221425
Head and Neck Neoplasms	Associate	22507853
Hypoalphalipoproteinemias	Associate	32541515
Hypoxia	Stimulate	37730658
Hypoxia Brain	Stimulate	37730658
Keratoconus	Associate	33596621, 37990318
Lung Neoplasms	Associate	19025616, 21489244
Nasopharyngeal Carcinoma	Associate	30935420, 32541515
Neoplasms	Associate	21251908, 22761399, 24387105, 24677340, 37730658
Precancerous Conditions	Associate	26580399
Pterygium	Associate	24825356, 25221425
Pulmonary Disease Chronic Obstructive	Associate	24188068, 25036363
Pulmonary Disease Chronic Obstructive	Stimulate	36475041
Scleroderma Systemic	Associate	36389675
Sjogren Larsson Syndrome	Associate	21684788
Stomach Neoplasms	Associate	28586067

ALDH3A1 (aldehyde dehydrogenase 3 family member A1)