Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2173
Gene name	Fatty acid binding protein 7
Gene symbol	FABP7
Synonyms (NCBI Gene)	B-FABPBLBPFABPBMRG
Chromosome	6
Chromosome location	6q22.31
Summary	The gene encodes a small, highly conserved cytoplasmic protein that bind long-chain fatty acids and other hydrophobic ligands. The encoded protein is important in the establishment of the radial glial fiber in the developing brain. Alternative splicing an

Show/Hide all (29)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021802	hsa-miR-132-3p	Microarray	17612493
MIRT529182	hsa-miR-16-1-3p	PAR-CLIP	22012620
MIRT529181	hsa-miR-1224-3p	PAR-CLIP	22012620
MIRT529180	hsa-miR-2114-3p	PAR-CLIP	22012620
MIRT529179	hsa-miR-6823-3p	PAR-CLIP	22012620
MIRT529178	hsa-miR-4697-3p	PAR-CLIP	22012620
MIRT529177	hsa-miR-223-3p	PAR-CLIP	22012620
MIRT529182	hsa-miR-16-1-3p	PAR-CLIP	22012620
MIRT529181	hsa-miR-1224-3p	PAR-CLIP	22012620
MIRT529180	hsa-miR-2114-3p	PAR-CLIP	22012620
MIRT529179	hsa-miR-6823-3p	PAR-CLIP	22012620
MIRT529178	hsa-miR-4697-3p	PAR-CLIP	22012620
MIRT529177	hsa-miR-223-3p	PAR-CLIP	22012620
MIRT529177	hsa-miR-223-3p	Luciferase reporter assayWestern blottingqRT-PCR	35355424
MIRT2527122	hsa-miR-1224-5p	CLIP-seq
MIRT2527123	hsa-miR-3672	CLIP-seq
MIRT2527124	hsa-miR-3915	CLIP-seq
MIRT2527125	hsa-miR-3928	CLIP-seq
MIRT2527126	hsa-miR-4261	CLIP-seq
MIRT2527127	hsa-miR-4329	CLIP-seq
MIRT2527128	hsa-miR-4496	CLIP-seq
MIRT2527129	hsa-miR-4689	CLIP-seq
MIRT2527130	hsa-miR-548a-3p	CLIP-seq
MIRT2527131	hsa-miR-548ae	CLIP-seq
MIRT2527132	hsa-miR-548aj	CLIP-seq
MIRT2527133	hsa-miR-548am	CLIP-seq
MIRT2527134	hsa-miR-548e	CLIP-seq
MIRT2527135	hsa-miR-548f	CLIP-seq
MIRT2527136	hsa-miR-548x	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
NFIC	Unknown	10896661;19540848;21771320
PAX6	Activation	22583899
POU3F2	Unknown	21771320

Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005504	Function	Fatty acid binding	IBA
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS
GO:0007399	Process	Nervous system development	TAS	9375786
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	9250612
GO:0008289	Function	Lipid binding	IEA
GO:0008289	Function	Lipid binding	TAS	9375786
GO:0015908	Process	Fatty acid transport	IBA
GO:0050673	Process	Epithelial cell proliferation	IEA

MIM	HGNC	e!Ensembl
602965	3562	ENSG00000164434

O15540

Protein name

Fatty acid-binding protein, brain (Brain lipid-binding protein) (BLBP) (Brain-type fatty acid-binding protein) (B-FABP) (Fatty acid-binding protein 7) (Mammary-derived growth inhibitor related)

Protein function

B-FABP could be involved in the transport of a so far unknown hydrophobic ligand with potential morphogenic activity during CNS development. It is required for the establishment of the radial glial fiber system in developing brain, a system that

PDB

1FDQ , 1FE3 , 1JJX , 5URA , 6L9O , 7E25 , 8IVF , 8IVL

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00061	Lipocalin	7 → 132	Lipocalin / cytosolic fatty-acid binding protein family	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain and other neural tissues.

Sequence

MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKN
TEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTF
GDVVAVRHYEKA

Sequence length

132

Interactions

View interactions

	KEGG		Reactome
	PPAR signaling pathway		Triglyceride catabolism

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Cervical cancer	Benign	rs114216518	RCV005911986

Show/Hide Text Mining Associations (26)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Alzheimer Disease	Associate	36776048
Astrocytoma	Associate	16623952, 17898869
Bicuspid Aortic Valve Disease	Associate	36071494
Breast Neoplasms	Associate	25389781, 33176622, 35355424, 35562758, 36077333, 36581948
Carcinoma Adenoid Cystic	Associate	29141398
Carcinoma Non Small Cell Lung	Associate	35269427
Carcinoma Renal Cell	Associate	17083565, 21767383, 21771320, 24302177, 28292269
Carcinoma Renal Cell	Stimulate	19622156, 30442117
Glioblastoma	Associate	16623952, 21156036, 21771320, 29642372, 34444824, 34716958, 36325660
Glioma	Associate	10896661, 15827123, 16623952, 17898869, 20834042, 23839947, 34716958, 35783014, 36325660
Hereditary Breast and Ovarian Cancer Syndrome	Associate	25389781
Hirschsprung Disease	Associate	24966941
Hypoxia	Associate	25263561
Hypoxia	Stimulate	33789996
Lymphoma Large B Cell Diffuse	Associate	25114248
Melanoma	Associate	15900300, 18826602, 19587692, 21771320, 23028975
Melanoma Cutaneous Malignant	Associate	19587692
Neoplasm Metastasis	Stimulate	30442117
Neoplasms	Associate	17083565, 17898869, 18826602, 19587692, 20834042, 21059815, 34444824, 34716958, 35269427, 35562758, 36325660
Nervous System Neoplasms	Associate	35783014
Poroma	Associate	25389781
Pulmonary Disease Chronic Obstructive	Associate	30845926
Purpura Thrombotic Thrombocytopenic	Associate	27762046
Thrombotic thrombocytopenic purpura acquired	Associate	27762046
Triple Negative Breast Neoplasms	Associate	31974598, 36077333
Uterine Cervical Neoplasms	Associate	23255846

FABP7 (fatty acid binding protein 7)