FABP5 (fatty acid binding protein 5)

Gene

• Entrez ID: 2171
• Gene name: Fatty acid binding protein 5
• Gene symbol: FABP5
• Synonyms (NCBI Gene): E-FABP, EFABP, KFABP, PA-FABP, PAFABP
• Chromosome: 8
• Chromosome location: 8q21.13
• Summary: This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fa

Transcription factors

Transcription factor	Regulation	Reference
KLF2	Repression	20424164

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001972	Function	Retinoic acid binding	IEA
GO:0005324	Function	Long-chain fatty acid transmembrane transporter activity	IMP	21395585
GO:0005504	Function	Fatty acid binding	IBA
GO:0005504	Function	Fatty acid binding	IDA	8092987
GO:0005504	Function	Fatty acid binding	TAS	8092987
GO:0005515	Function	Protein binding	IPI	12839573
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	24692551
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	8092987
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	16130169
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0006006	Process	Glucose metabolic process	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006629	Process	Lipid metabolic process	TAS	8092987
GO:0006656	Process	Phosphatidylcholine biosynthetic process	IEA
GO:0006869	Process	Lipid transport	IEA
GO:0008289	Function	Lipid binding	IEA
GO:0008289	Function	Lipid binding	TAS	1512466
GO:0008544	Process	Epidermis development	TAS	1512466
GO:0010829	Process	Negative regulation of D-glucose transmembrane transport	IEA
GO:0014069	Component	Postsynaptic density	IEA
GO:0014069	Component	Postsynaptic density	ISS
GO:0015908	Process	Fatty acid transport	IBA
GO:0015909	Process	Long-chain fatty acid transport	IMP	21395585
GO:0030667	Component	Secretory granule membrane	TAS
GO:0031392	Process	Regulation of prostaglandin biosynthetic process	IEA
GO:0035360	Process	Positive regulation of peroxisome proliferator activated receptor signaling pathway	IEA
GO:0035578	Component	Azurophil granule lumen	TAS
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042802	Function	Identical protein binding	IDA	24531463
GO:0045202	Component	Synapse	IEA
GO:0045202	Component	Synapse	ISS
GO:0051930	Process	Regulation of sensory perception of pain	IEA
GO:0070062	Component	Extracellular exosome	HDA	20458337, 23533145
GO:0098921	Process	Retrograde trans-synaptic signaling by endocannabinoid	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099092	Component	Postsynaptic density, intracellular component	IEA
GO:0099178	Process	Regulation of retrograde trans-synaptic signaling by endocanabinoid	IEA
GO:0099178	Process	Regulation of retrograde trans-synaptic signaling by endocanabinoid	ISS
GO:0099524	Component	Postsynaptic cytosol	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	24603714
GO:1990379	Process	Lipid transport across blood-brain barrier	IMP	21395585

Other IDs

• MIM: 605168
• HGNC: 3560
• e!Ensembl: ENSG00000164687

Protein

• UniProt ID: Q01469
• Protein name: Fatty acid-binding protein 5 (Epidermal-type fatty acid-binding protein) (E-FABP) (Fatty acid-binding protein, epidermal) (Psoriasis-associated fatty acid-binding protein homolog) (PA-FABP)
• Protein function: Intracellular carrier for long-chain fatty acids and related active lipids, such as endocannabinoids, that regulate the metabolism and actions of the ligands they bind. In addition to the cytosolic transport, selectively delivers specific fatty
• PDB: 1B56, 1JJJ, 4AZM, 4AZR, 4LKP, 4LKT, 5HZ5, 5UR9, 7FWI, 7FXD, 7FY0, 7FYD, 7G01, 7G04, 7G0B, 7G0E, 7G1Q
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00061	Lipocalin	8 → 134	Lipocalin / cytosolic fatty-acid binding protein family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Keratinocytes; highly expressed in psoriatic skin (PubMed:8092987). Expressed in brain gray matter (PubMed:21395585). {ECO:0000269|PubMed:21395585, ECO:0000269|PubMed:8092987}.
• Sequence:

  MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTL
  KTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVEC
  VMNNVTCTRIYEKVE

• Sequence length: 135

Pathways

KEGG:

PPAR signaling pathway

Reactome:

Triglyceride catabolism
Signaling by Retinoic Acid
Neutrophil degranulation