Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2170
Gene name Gene Name - the full gene name approved by the HGNC.	Fatty acid binding protein 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	FABP3
Synonyms (NCBI Gene) Gene synonyms aliases	FABP11, H-FABP, M-FABP, MDGI, O-FABP
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p35.2
Summary Summary of gene provided in NCBI Entrez Gene.	The intracellular fatty acid-binding proteins (FABPs) belongs to a multigene family. FABPs are divided into at least three distinct types, namely the hepatic-, intestinal- and cardiac-type. They form 14-15 kDa proteins and are thought to participate in th

Show/Hide all(94)

miRTarBase ID	miRNA	Experiments	Reference
MIRT007213	hsa-miR-1-3p	ELISA, Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot	23141496
MIRT477175	hsa-miR-1252-3p	PAR-CLIP	23592263
MIRT477174	hsa-miR-5680	PAR-CLIP	23592263
MIRT477173	hsa-miR-3125	PAR-CLIP	23592263
MIRT477172	hsa-miR-3916	PAR-CLIP	23592263
MIRT477171	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT477170	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT477169	hsa-miR-1827	PAR-CLIP	23592263
MIRT477168	hsa-miR-4785	PAR-CLIP	23592263
MIRT477167	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT477166	hsa-miR-4663	PAR-CLIP	23592263
MIRT477165	hsa-miR-7160-5p	PAR-CLIP	23592263
MIRT477164	hsa-miR-8077	PAR-CLIP	23592263
MIRT477162	hsa-miR-3907	PAR-CLIP	23592263
MIRT477163	hsa-miR-3678-3p	PAR-CLIP	23592263
MIRT477175	hsa-miR-1252-3p	PAR-CLIP	23592263
MIRT477174	hsa-miR-5680	PAR-CLIP	23592263
MIRT477173	hsa-miR-3125	PAR-CLIP	23592263
MIRT477172	hsa-miR-3916	PAR-CLIP	23592263
MIRT477171	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT477170	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT477169	hsa-miR-1827	PAR-CLIP	23592263
MIRT477168	hsa-miR-4785	PAR-CLIP	23592263
MIRT477167	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT477166	hsa-miR-4663	PAR-CLIP	23592263
MIRT477165	hsa-miR-7160-5p	PAR-CLIP	23592263
MIRT477164	hsa-miR-8077	PAR-CLIP	23592263
MIRT477162	hsa-miR-3907	PAR-CLIP	23592263
MIRT477163	hsa-miR-3678-3p	PAR-CLIP	23592263
MIRT974901	hsa-miR-1207-3p	CLIP-seq
MIRT974902	hsa-miR-1290	CLIP-seq
MIRT974903	hsa-miR-18a	CLIP-seq
MIRT974904	hsa-miR-18b	CLIP-seq
MIRT974905	hsa-miR-3167	CLIP-seq
MIRT974906	hsa-miR-3677-3p	CLIP-seq
MIRT974907	hsa-miR-383	CLIP-seq
MIRT974908	hsa-miR-3920	CLIP-seq
MIRT974909	hsa-miR-4438	CLIP-seq
MIRT974910	hsa-miR-4698	CLIP-seq
MIRT974911	hsa-miR-4735-3p	CLIP-seq
MIRT974912	hsa-miR-4772-5p	CLIP-seq
MIRT974913	hsa-miR-876-5p	CLIP-seq
MIRT1988847	hsa-miR-192	CLIP-seq
MIRT1988848	hsa-miR-215	CLIP-seq
MIRT2223235	hsa-miR-4795-3p	CLIP-seq
MIRT974902	hsa-miR-1290	CLIP-seq
MIRT974905	hsa-miR-3167	CLIP-seq
MIRT974906	hsa-miR-3677-3p	CLIP-seq
MIRT2449058	hsa-miR-4432	CLIP-seq
MIRT974910	hsa-miR-4698	CLIP-seq
MIRT2449059	hsa-miR-548an	CLIP-seq
MIRT2449060	hsa-miR-642b	CLIP-seq
MIRT974913	hsa-miR-876-5p	CLIP-seq
MIRT2449059	hsa-miR-548an	CLIP-seq
MIRT2527108	hsa-miR-1244	CLIP-seq
MIRT974902	hsa-miR-1290	CLIP-seq
MIRT2527109	hsa-miR-1293	CLIP-seq
MIRT2527110	hsa-miR-148a	CLIP-seq
MIRT2527111	hsa-miR-148b	CLIP-seq
MIRT2527112	hsa-miR-152	CLIP-seq
MIRT1988847	hsa-miR-192	CLIP-seq
MIRT1988848	hsa-miR-215	CLIP-seq
MIRT974905	hsa-miR-3167	CLIP-seq
MIRT2527113	hsa-miR-3194-3p	CLIP-seq
MIRT2527114	hsa-miR-3663-3p	CLIP-seq
MIRT974906	hsa-miR-3677-3p	CLIP-seq
MIRT2449058	hsa-miR-4432	CLIP-seq
MIRT2527115	hsa-miR-4483	CLIP-seq
MIRT974910	hsa-miR-4698	CLIP-seq
MIRT2527116	hsa-miR-4709-5p	CLIP-seq
MIRT2527117	hsa-miR-4802-5p	CLIP-seq
MIRT2527118	hsa-miR-545	CLIP-seq
MIRT2449059	hsa-miR-548an	CLIP-seq
MIRT2527119	hsa-miR-579	CLIP-seq
MIRT2527120	hsa-miR-591	CLIP-seq
MIRT2449060	hsa-miR-642b	CLIP-seq
MIRT2527121	hsa-miR-760	CLIP-seq
MIRT974913	hsa-miR-876-5p	CLIP-seq
MIRT2527108	hsa-miR-1244	CLIP-seq
MIRT974902	hsa-miR-1290	CLIP-seq
MIRT2527110	hsa-miR-148a	CLIP-seq
MIRT2527111	hsa-miR-148b	CLIP-seq
MIRT2527112	hsa-miR-152	CLIP-seq
MIRT974905	hsa-miR-3167	CLIP-seq
MIRT974906	hsa-miR-3677-3p	CLIP-seq
MIRT2449058	hsa-miR-4432	CLIP-seq
MIRT974910	hsa-miR-4698	CLIP-seq
MIRT2527116	hsa-miR-4709-5p	CLIP-seq
MIRT2527117	hsa-miR-4802-5p	CLIP-seq
MIRT2527118	hsa-miR-545	CLIP-seq
MIRT2527119	hsa-miR-579	CLIP-seq
MIRT2527120	hsa-miR-591	CLIP-seq
MIRT2449060	hsa-miR-642b	CLIP-seq
MIRT974913	hsa-miR-876-5p	CLIP-seq

Show/Hide all(26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005324	Function	Long-chain fatty acid transporter activity	IEA
GO:0005515	Function	Protein binding	IPI	20802519, 21516116, 25416956, 32296183
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IDA	23141496
GO:0005829	Component	Cytosol	TAS	23873799
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0008092	Function	Cytoskeletal protein binding	IPI	17987659
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	7962070
GO:0015909	Process	Long-chain fatty acid transport	ISS	10224224
GO:0016528	Component	Sarcoplasm	IEA
GO:0019433	Process	Triglyceride catabolic process	TAS
GO:0032365	Process	Intracellular lipid transport	ISS
GO:0032868	Process	Response to insulin	IEA
GO:0036041	Function	Long-chain fatty acid binding	IDA	3421901
GO:0042493	Process	Response to drug	IEA
GO:0042632	Process	Cholesterol homeostasis	ISS
GO:0046320	Process	Regulation of fatty acid oxidation	ISS
GO:0050543	Function	Icosatetraenoic acid binding	IEA
GO:0050873	Process	Brown fat cell differentiation	IEA
GO:0055091	Process	Phospholipid homeostasis	ISS
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070538	Function	Oleic acid binding	IDA	3421901
GO:0070542	Process	Response to fatty acid	IEA
GO:0071073	Process	Positive regulation of phospholipid biosynthetic process	IC	3421901
GO:0140214	Process	Positive regulation of long-chain fatty acid import into cell	ISS	10224224
GO:2001245	Process	Regulation of phosphatidylcholine biosynthetic process	IEA

MIM	HGNC	e!Ensembl
134651	3557	ENSG00000121769

Protein

UniProt ID

P05413

Protein name

Fatty acid-binding protein, heart (Fatty acid-binding protein 3) (Heart-type fatty acid-binding protein) (H-FABP) (Mammary-derived growth inhibitor) (MDGI) (Muscle fatty acid-binding protein) (M-FABP)

Protein function

FABPs are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.

PDB

1G5W , 1HMR , 1HMS , 1HMT , 2HMB , 3RSW , 3WBG , 3WVM , 3WXQ , 4TJZ , 4TKB , 4TKH , 4TKJ , 4WBK , 5B27 , 5B28 , 5B29 , 5CE4 , 5HZ9 , 6AQ1 , 7EGO , 7EUV , 7EUW , 7FBF , 7FBM , 7FBN , 7FC4 , 7FCG , 7FCX , 7FD7 , 7FDT , 7FDU , 7FDX , 7FEK , 7FEU , 7FEZ , 7FF6 , 7FFK , 7FFX , 7FG1 , 7FG5 , 7FZQ , 7V2G , 7V5U , 7VB1 , 7WCI , 7WD6 , 7WDJ , 7WE5 , 7WF0 , 7WJ1

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00061	Lipocalin	6 → 132	Lipocalin / cytosolic fatty-acid binding protein family	Domain

Sequence

MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKN
TEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTH
GTAVCTRTYEKEA

Sequence length

133

Interactions

View interactions

	KEGG		Reactome
	PPAR signaling pathway		Triglyceride catabolism

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Myopathy	Myopathy	rs137854521, rs386834236, rs121908557, rs121909092, rs111033570, rs104894299, rs104894294, rs121909273, rs121909274, rs121909275, rs199474699, rs199476140, rs118192165, rs118192169, rs118192166 View all (81 more)	18308699

Show/Hide Text Mining Associations (60)

Disease Name	Relationship Type	References
Associations from Text Mining
Acute Coronary Syndrome	Associate	21535886, 22044705
Acute Kidney Injury	Associate	17721027, 25212385, 25830762
Adenocarcinoma	Associate	18318776
Alzheimer Disease	Associate	37454217, 40033432
Alzheimer Disease	Inhibit	37801139
Aortic Valve Disease	Associate	27250500
Atherosclerosis	Associate	21535886
Atrial Fibrillation	Inhibit	28807550
Atrial Fibrillation	Stimulate	32315296
Atrial Fibrillation	Associate	34798808
Atrophy	Associate	35584575
Breast Neoplasms	Associate	25287138, 32377505
Carcinoma Hepatocellular	Associate	31828095
Carcinoma Non Small Cell Lung	Associate	27323829
Cardiomyopathies	Associate	32041617
Cardiotoxicity	Associate	28094846
Cardiovascular Abnormalities	Associate	21535886
Cardiovascular Diseases	Associate	23510163, 32041617
Craniosynostoses	Stimulate	32184430
Diabetes Gestational	Associate	28846666, 32365792
Diabetes Mellitus	Stimulate	21535886, 32041617
Diabetic Cardiomyopathies	Stimulate	37355664
Diabetic Nephropathies	Associate	39510044
Esophageal Neoplasms	Associate	32707495, 35568702
Glucose Intolerance	Stimulate	21535886
Glucose Metabolism Disorders	Associate	32041617
Heart Defects Congenital	Associate	24899611
Heart Diseases	Associate	17721027, 25830762
Heart Failure	Associate	22701570, 24899611
Hydrocephalus Normal Pressure	Associate	37277809, 40033432
Hypoglycemia	Stimulate	21535886
Hypoxia	Associate	25263561
Inflammation	Associate	27864793
Intracranial Thrombosis	Associate	26081026
Leiomyosarcoma	Associate	23178314
Liver Diseases	Associate	28127194
Liver Failure	Associate	27864793
Long QT Syndrome	Associate	17721027
Lymphatic Metastasis	Stimulate	27323829
Malformations of Cortical Development	Associate	28222113
Metabolic Syndrome	Associate	23510163
Microphthalmia Syndromic 10	Associate	35584575
Mitral Valve Insufficiency	Associate	27250500
Myocardial Infarction	Associate	26212703
Neoplasms	Associate	33190987
Non alcoholic Fatty Liver Disease	Stimulate	28127194
Non ST Elevated Myocardial Infarction	Associate	26212703
Obesity	Associate	17721027
Obesity	Inhibit	29065800
Ovarian Neoplasms	Associate	27806724
Pneumonia	Associate	24899611
Pressure Ulcer	Associate	31490098
Sleep Wake Disorders	Associate	21535886
Squamous Cell Carcinoma of Head and Neck	Associate	36478991
Stomach Neoplasms	Associate	37036489
Stroke	Associate	21535886
Thinness	Associate	35584575
Triple Negative Breast Neoplasms	Associate	32377505
Urinary Bladder Neoplasms	Associate	21767383
Wounds and Injuries	Associate	26212703

FABP3 (fatty acid binding protein 3)