Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID	2170
Gene name	Fatty acid binding protein 3
Gene symbol	FABP3
Synonyms (NCBI Gene)	FABP11H-FABPM-FABPMDGIO-FABP
Chromosome	1
Chromosome location	1p35.2
Summary	The intracellular fatty acid-binding proteins (FABPs) belongs to a multigene family. FABPs are divided into at least three distinct types, namely the hepatic-, intestinal- and cardiac-type. They form 14-15 kDa proteins and are thought to participate in th

Show/Hide all (94)

miRTarBase ID	miRNA	Experiments	Reference
MIRT007213	hsa-miR-1-3p	ELISAImmunoprecipitaionLuciferase reporter assayqRT-PCRWestern blot	23141496
MIRT477175	hsa-miR-1252-3p	PAR-CLIP	23592263
MIRT477174	hsa-miR-5680	PAR-CLIP	23592263
MIRT477173	hsa-miR-3125	PAR-CLIP	23592263
MIRT477172	hsa-miR-3916	PAR-CLIP	23592263
MIRT477171	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT477170	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT477169	hsa-miR-1827	PAR-CLIP	23592263
MIRT477168	hsa-miR-4785	PAR-CLIP	23592263
MIRT477167	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT477166	hsa-miR-4663	PAR-CLIP	23592263
MIRT477165	hsa-miR-7160-5p	PAR-CLIP	23592263
MIRT477164	hsa-miR-8077	PAR-CLIP	23592263
MIRT477162	hsa-miR-3907	PAR-CLIP	23592263
MIRT477163	hsa-miR-3678-3p	PAR-CLIP	23592263
MIRT477175	hsa-miR-1252-3p	PAR-CLIP	23592263
MIRT477174	hsa-miR-5680	PAR-CLIP	23592263
MIRT477173	hsa-miR-3125	PAR-CLIP	23592263
MIRT477172	hsa-miR-3916	PAR-CLIP	23592263
MIRT477171	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT477170	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT477169	hsa-miR-1827	PAR-CLIP	23592263
MIRT477168	hsa-miR-4785	PAR-CLIP	23592263
MIRT477167	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT477166	hsa-miR-4663	PAR-CLIP	23592263
MIRT477165	hsa-miR-7160-5p	PAR-CLIP	23592263
MIRT477164	hsa-miR-8077	PAR-CLIP	23592263
MIRT477162	hsa-miR-3907	PAR-CLIP	23592263
MIRT477163	hsa-miR-3678-3p	PAR-CLIP	23592263
MIRT974901	hsa-miR-1207-3p	CLIP-seq
MIRT974902	hsa-miR-1290	CLIP-seq
MIRT974903	hsa-miR-18a	CLIP-seq
MIRT974904	hsa-miR-18b	CLIP-seq
MIRT974905	hsa-miR-3167	CLIP-seq
MIRT974906	hsa-miR-3677-3p	CLIP-seq
MIRT974907	hsa-miR-383	CLIP-seq
MIRT974908	hsa-miR-3920	CLIP-seq
MIRT974909	hsa-miR-4438	CLIP-seq
MIRT974910	hsa-miR-4698	CLIP-seq
MIRT974911	hsa-miR-4735-3p	CLIP-seq
MIRT974912	hsa-miR-4772-5p	CLIP-seq
MIRT974913	hsa-miR-876-5p	CLIP-seq
MIRT1988847	hsa-miR-192	CLIP-seq
MIRT1988848	hsa-miR-215	CLIP-seq
MIRT2223235	hsa-miR-4795-3p	CLIP-seq
MIRT974902	hsa-miR-1290	CLIP-seq
MIRT974905	hsa-miR-3167	CLIP-seq
MIRT974906	hsa-miR-3677-3p	CLIP-seq
MIRT2449058	hsa-miR-4432	CLIP-seq
MIRT974910	hsa-miR-4698	CLIP-seq
MIRT2449059	hsa-miR-548an	CLIP-seq
MIRT2449060	hsa-miR-642b	CLIP-seq
MIRT974913	hsa-miR-876-5p	CLIP-seq
MIRT2449059	hsa-miR-548an	CLIP-seq
MIRT2527108	hsa-miR-1244	CLIP-seq
MIRT974902	hsa-miR-1290	CLIP-seq
MIRT2527109	hsa-miR-1293	CLIP-seq
MIRT2527110	hsa-miR-148a	CLIP-seq
MIRT2527111	hsa-miR-148b	CLIP-seq
MIRT2527112	hsa-miR-152	CLIP-seq
MIRT1988847	hsa-miR-192	CLIP-seq
MIRT1988848	hsa-miR-215	CLIP-seq
MIRT974905	hsa-miR-3167	CLIP-seq
MIRT2527113	hsa-miR-3194-3p	CLIP-seq
MIRT2527114	hsa-miR-3663-3p	CLIP-seq
MIRT974906	hsa-miR-3677-3p	CLIP-seq
MIRT2449058	hsa-miR-4432	CLIP-seq
MIRT2527115	hsa-miR-4483	CLIP-seq
MIRT974910	hsa-miR-4698	CLIP-seq
MIRT2527116	hsa-miR-4709-5p	CLIP-seq
MIRT2527117	hsa-miR-4802-5p	CLIP-seq
MIRT2527118	hsa-miR-545	CLIP-seq
MIRT2449059	hsa-miR-548an	CLIP-seq
MIRT2527119	hsa-miR-579	CLIP-seq
MIRT2527120	hsa-miR-591	CLIP-seq
MIRT2449060	hsa-miR-642b	CLIP-seq
MIRT2527121	hsa-miR-760	CLIP-seq
MIRT974913	hsa-miR-876-5p	CLIP-seq
MIRT2527108	hsa-miR-1244	CLIP-seq
MIRT974902	hsa-miR-1290	CLIP-seq
MIRT2527110	hsa-miR-148a	CLIP-seq
MIRT2527111	hsa-miR-148b	CLIP-seq
MIRT2527112	hsa-miR-152	CLIP-seq
MIRT974905	hsa-miR-3167	CLIP-seq
MIRT974906	hsa-miR-3677-3p	CLIP-seq
MIRT2449058	hsa-miR-4432	CLIP-seq
MIRT974910	hsa-miR-4698	CLIP-seq
MIRT2527116	hsa-miR-4709-5p	CLIP-seq
MIRT2527117	hsa-miR-4802-5p	CLIP-seq
MIRT2527118	hsa-miR-545	CLIP-seq
MIRT2527119	hsa-miR-579	CLIP-seq
MIRT2527120	hsa-miR-591	CLIP-seq
MIRT2449060	hsa-miR-642b	CLIP-seq
MIRT974913	hsa-miR-876-5p	CLIP-seq

Show/Hide all (39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005324	Function	Long-chain fatty acid transmembrane transporter activity	IEA
GO:0005504	Function	Fatty acid binding	IEA
GO:0005515	Function	Protein binding	IPI	21516116, 25416956, 32296183
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IDA	23141496
GO:0005615	Component	Extracellular space	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS	23873799
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0008092	Function	Cytoskeletal protein binding	IPI	17987659
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	7962070
GO:0008289	Function	Lipid binding	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0015909	Process	Long-chain fatty acid transport	IBA
GO:0015909	Process	Long-chain fatty acid transport	IEA
GO:0015909	Process	Long-chain fatty acid transport	ISS	10224224
GO:0016528	Component	Sarcoplasm	IEA
GO:0032365	Process	Intracellular lipid transport	IEA
GO:0032365	Process	Intracellular lipid transport	ISS
GO:0032868	Process	Response to insulin	IEA
GO:0036041	Function	Long-chain fatty acid binding	IBA
GO:0036041	Function	Long-chain fatty acid binding	IDA	3421901
GO:0042632	Process	Cholesterol homeostasis	IEA
GO:0042632	Process	Cholesterol homeostasis	ISS
GO:0046320	Process	Regulation of fatty acid oxidation	IEA
GO:0046320	Process	Regulation of fatty acid oxidation	ISS
GO:0050543	Function	Icosatetraenoic acid binding	IEA
GO:0050873	Process	Brown fat cell differentiation	IEA
GO:0055091	Process	Phospholipid homeostasis	IEA
GO:0055091	Process	Phospholipid homeostasis	ISS
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070538	Function	Oleic acid binding	IDA	3421901
GO:0070542	Process	Response to fatty acid	IEA
GO:0071073	Process	Positive regulation of phospholipid biosynthetic process	IC	3421901
GO:0140214	Process	Positive regulation of long-chain fatty acid import into cell	IEA
GO:0140214	Process	Positive regulation of long-chain fatty acid import into cell	ISS	10224224
GO:2001245	Process	Regulation of phosphatidylcholine biosynthetic process	IEA

MIM	HGNC	e!Ensembl
134651	3557	ENSG00000121769

P05413

Protein name

Fatty acid-binding protein, heart (Fatty acid-binding protein 3) (Heart-type fatty acid-binding protein) (H-FABP) (Mammary-derived growth inhibitor) (MDGI) (Muscle fatty acid-binding protein) (M-FABP)

Protein function

FABPs are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.

PDB

1G5W , 1HMR , 1HMS , 1HMT , 2HMB , 3RSW , 3WBG , 3WVM , 3WXQ , 4TJZ , 4TKB , 4TKH , 4TKJ , 4WBK , 5B27 , 5B28 , 5B29 , 5CE4 , 5HZ9 , 6AQ1 , 7EGO , 7EUV , 7EUW , 7FBF , 7FBM , 7FBN , 7FC4 , 7FCG , 7FCX , 7FD7 , 7FDT , 7FDU , 7FDX , 7FEK , 7FEU , 7FEZ , 7FF6 , 7FFK , 7FFX , 7FG1 , 7FG5 , 7FZQ , 7V2G , 7V5U , 7VB1 , 7WCI , 7WD6 , 7WDJ , 7WE5 , 7WF0 , 7WJ1

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00061	Lipocalin	6 → 132	Lipocalin / cytosolic fatty-acid binding protein family	Domain

Sequence

MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKN
TEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTH
GTAVCTRTYEKEA

Sequence length

133

Interactions

View interactions

	KEGG		Reactome
	PPAR signaling pathway		Triglyceride catabolism

FABP3 (fatty acid binding protein 3)