Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	2168
Gene name	Fatty acid binding protein 1
Gene symbol	FABP1
Synonyms (NCBI Gene)	FABPLL-FABP
Chromosome	2
Chromosome location	2p11.2
Summary	This gene encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. This protein and FABP6 (the ileal fa

Show/Hide all (5)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018987	hsa-miR-335-5p	Microarray	18185580
MIRT733562	hsa-miR-603	Immunocytochemistry (ICC)Western blotting	34056002
MIRT733562	hsa-miR-603	Western blottingqRT-PCR	34056002
MIRT1988836	hsa-miR-4775	CLIP-seq
MIRT1988837	hsa-miR-590-3p	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
HNF1A	Unknown	20357450

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003682	Function	Chromatin binding	IEA
GO:0005504	Function	Fatty acid binding	IBA
GO:0005515	Function	Protein binding	IPI	25416956, 28514442, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005782	Component	Peroxisomal matrix	ISS
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0008289	Function	Lipid binding	IEA
GO:0015908	Process	Fatty acid transport	IBA
GO:0016209	Function	Antioxidant activity	IDA	16175609
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070301	Process	Cellular response to hydrogen peroxide	IDA	16175609
GO:0071456	Process	Cellular response to hypoxia	IDA	16175609
GO:0098869	Process	Cellular oxidant detoxification	IEA
GO:1990748	Process	Cellular detoxification	IDA	16175609

MIM	HGNC	e!Ensembl
134650	3555	ENSG00000163586

P07148

Protein name

Fatty acid-binding protein, liver (Fatty acid-binding protein 1) (Liver-type fatty acid-binding protein) (L-FABP)

Protein function

Plays a role in lipoprotein-mediated cholesterol uptake in hepatocytes (PubMed:25732850). Binds cholesterol (PubMed:25732850). Binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. M

PDB

2F73 , 2L67 , 2L68 , 2LKK , 2PY1 , 3B2H , 3B2I , 3B2J , 3B2K , 3B2L , 3STK , 3STM , 3STN , 3VG2 , 3VG3 , 3VG4 , 3VG5 , 3VG6 , 3VG7 , 6DO6 , 6DO7 , 6DRG , 6MP4 , 7DZE , 7DZF , 7DZG , 7DZH , 7DZI , 7DZJ , 7DZK , 7DZL , 7FXO , 7FY8 , 7FYA , 7G00 , 7G0W , 7G1X

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14651	Lipocalin_7	1 → 127		Domain

Sequence

MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQ
NEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVF
KRISKRI

Sequence length

127

Interactions

View interactions

	KEGG		Reactome
	PPAR signaling pathway Alcoholic liver disease Fat digestion and absorption		Triglyceride catabolism Heme degradation PPARA activates gene expression Regulation of lipid metabolism by PPARalpha

FABP1 (fatty acid binding protein 1)