FABP1 (fatty acid binding protein 1)

Gene

• Entrez ID: 2168
• Gene name: Fatty acid binding protein 1
• Gene symbol: FABP1
• Synonyms (NCBI Gene): FABPL, L-FABP
• Chromosome: 2
• Chromosome location: 2p11.2
• Summary: This gene encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. This protein and FABP6 (the ileal fa

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018987	hsa-miR-335-5p	Microarray	18185580
MIRT733562	hsa-miR-603	Immunocytochemistry (ICC), Western blotting	34056002
MIRT733562	hsa-miR-603	Western blotting, qRT-PCR	34056002
MIRT1988836	hsa-miR-4775	CLIP-seq
MIRT1988837	hsa-miR-590-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
HNF1A	Unknown	20357450

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003682	Function	Chromatin binding	IEA
GO:0005324	Function	Long-chain fatty acid transporter activity	IEA
GO:0005504	Function	Fatty acid binding	IEA
GO:0005515	Function	Protein binding	IPI	25416956
GO:0005543	Function	Phospholipid binding	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005782	Component	Peroxisomal matrix	ISS
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0008144	Function	Drug binding	IEA
GO:0015909	Process	Long-chain fatty acid transport	IEA
GO:0016209	Function	Antioxidant activity	IDA	16175609
GO:0019216	Process	Regulation of lipid metabolic process	TAS
GO:0019433	Process	Triglyceride catabolic process	TAS
GO:0032000	Process	Positive regulation of fatty acid beta-oxidation	IEA
GO:0032052	Function	Bile acid binding	IEA
GO:0032991	Component	Protein-containing complex	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IDA	16175609
GO:0043154	Process	Negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	16175609
GO:0045179	Component	Apical cortex	IEA
GO:0050892	Process	Intestinal absorption	IEA
GO:0051345	Process	Positive regulation of hydrolase activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070301	Process	Cellular response to hydrogen peroxide	IDA	16175609
GO:0071456	Process	Cellular response to hypoxia	IDA	16175609
GO:0098869	Process	Cellular oxidant detoxification	IEA

Other IDs

• MIM: 134650
• HGNC: 3555
• e!Ensembl: ENSG00000163586

Protein

• UniProt ID: P07148
• Protein name: Fatty acid-binding protein, liver (Fatty acid-binding protein 1) (Liver-type fatty acid-binding protein) (L-FABP)
• Protein function: Plays a role in lipoprotein-mediated cholesterol uptake in hepatocytes (PubMed:25732850). Binds cholesterol (PubMed:25732850). Binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. M
• PDB: 2F73, 2L67, 2L68, 2LKK, 2PY1, 3B2H, 3B2I, 3B2J, 3B2K, 3B2L, 3STK, 3STM, 3STN, 3VG2, 3VG3, 3VG4, 3VG5, 3VG6, 3VG7, 6DO6, 6DO7, 6DRG, 6MP4, 7DZE, 7DZF, 7DZG, 7DZH, 7DZI, 7DZJ, 7DZK, 7DZL, 7FXO, 7FY8, 7FYA, 7G00, 7G0W, 7G1X
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF14651	Lipocalin_7	1 → 127		Domain

• Sequence:

  MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQ
  NEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVF
  KRISKRI

• Sequence length: 127

Pathways

KEGG:

PPAR signaling pathway
Alcoholic liver disease
Fat digestion and absorption

Reactome:

Triglyceride catabolism
Heme degradation
PPARA activates gene expression
Regulation of lipid metabolism by PPARalpha