Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2104
Gene name Gene Name - the full gene name approved by the HGNC.	Estrogen related receptor gamma
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ESRRG
Synonyms (NCBI Gene) Gene synonyms aliases	ERR-gamma, ERR3, ERRg, ERRgamma, NR3B3
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q41
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the estrogen receptor-related receptor (ESRR) family, which belongs to the nuclear hormone receptor superfamily. All members of the ESRR family share an almost identical DNA binding domain, which is composed of two C4-type zi

Show/Hide all(143)

miRTarBase ID	miRNA	Experiments	Reference
MIRT437839	hsa-miR-205-5p	Luciferase reporter assay	23589079
MIRT437839	hsa-miR-205-5p	Luciferase reporter assay	23589079
MIRT668525	hsa-miR-935	HITS-CLIP	23824327
MIRT668524	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT668523	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT668522	hsa-miR-5580-5p	HITS-CLIP	23824327
MIRT668521	hsa-miR-2115-5p	HITS-CLIP	23824327
MIRT668520	hsa-miR-6815-3p	HITS-CLIP	23824327
MIRT668519	hsa-miR-4492	HITS-CLIP	23824327
MIRT668518	hsa-miR-4498	HITS-CLIP	23824327
MIRT668517	hsa-miR-5001-5p	HITS-CLIP	23824327
MIRT668516	hsa-miR-762	HITS-CLIP	23824327
MIRT668525	hsa-miR-935	HITS-CLIP	23824327
MIRT668524	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT668523	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT668522	hsa-miR-5580-5p	HITS-CLIP	23824327
MIRT668521	hsa-miR-2115-5p	HITS-CLIP	23824327
MIRT668520	hsa-miR-6815-3p	HITS-CLIP	23824327
MIRT668519	hsa-miR-4492	HITS-CLIP	23824327
MIRT668518	hsa-miR-4498	HITS-CLIP	23824327
MIRT668517	hsa-miR-5001-5p	HITS-CLIP	23824327
MIRT668516	hsa-miR-762	HITS-CLIP	23824327
MIRT971065	hsa-miR-1267	CLIP-seq
MIRT971066	hsa-miR-1323	CLIP-seq
MIRT971067	hsa-miR-148a	CLIP-seq
MIRT971068	hsa-miR-148b	CLIP-seq
MIRT971069	hsa-miR-152	CLIP-seq
MIRT971070	hsa-miR-200b	CLIP-seq
MIRT971071	hsa-miR-200c	CLIP-seq
MIRT971072	hsa-miR-23a	CLIP-seq
MIRT971073	hsa-miR-23b	CLIP-seq
MIRT971074	hsa-miR-23c	CLIP-seq
MIRT971075	hsa-miR-335	CLIP-seq
MIRT971076	hsa-miR-361-5p	CLIP-seq
MIRT971077	hsa-miR-3688-3p	CLIP-seq
MIRT971078	hsa-miR-3690	CLIP-seq
MIRT971079	hsa-miR-3714	CLIP-seq
MIRT971080	hsa-miR-3941	CLIP-seq
MIRT971081	hsa-miR-3974	CLIP-seq
MIRT971082	hsa-miR-3978	CLIP-seq
MIRT971083	hsa-miR-4251	CLIP-seq
MIRT971084	hsa-miR-4254	CLIP-seq
MIRT971085	hsa-miR-4280	CLIP-seq
MIRT971086	hsa-miR-429	CLIP-seq
MIRT971087	hsa-miR-4424	CLIP-seq
MIRT971088	hsa-miR-4426	CLIP-seq
MIRT971089	hsa-miR-4504	CLIP-seq
MIRT971090	hsa-miR-4514	CLIP-seq
MIRT971091	hsa-miR-4643	CLIP-seq
MIRT971092	hsa-miR-4647	CLIP-seq
MIRT971093	hsa-miR-466	CLIP-seq
MIRT971094	hsa-miR-4662b	CLIP-seq
MIRT971095	hsa-miR-4672	CLIP-seq
MIRT971096	hsa-miR-4684-5p	CLIP-seq
MIRT971097	hsa-miR-4692	CLIP-seq
MIRT971098	hsa-miR-4703-3p	CLIP-seq
MIRT971099	hsa-miR-4704-3p	CLIP-seq
MIRT971100	hsa-miR-4789-3p	CLIP-seq
MIRT971101	hsa-miR-4795-3p	CLIP-seq
MIRT971102	hsa-miR-483-5p	CLIP-seq
MIRT971103	hsa-miR-493	CLIP-seq
MIRT971104	hsa-miR-539	CLIP-seq
MIRT971105	hsa-miR-542-3p	CLIP-seq
MIRT971106	hsa-miR-548o	CLIP-seq
MIRT971107	hsa-miR-563	CLIP-seq
MIRT971108	hsa-miR-622	CLIP-seq
MIRT971109	hsa-miR-940	CLIP-seq
MIRT971110	hsa-miR-942	CLIP-seq
MIRT971070	hsa-miR-200b	CLIP-seq
MIRT971071	hsa-miR-200c	CLIP-seq
MIRT1987691	hsa-miR-329	CLIP-seq
MIRT1987692	hsa-miR-3591-3p	CLIP-seq
MIRT1987693	hsa-miR-362-3p	CLIP-seq
MIRT971086	hsa-miR-429	CLIP-seq
MIRT1987694	hsa-miR-4446-5p	CLIP-seq
MIRT1987695	hsa-miR-4463	CLIP-seq
MIRT1987696	hsa-miR-4494	CLIP-seq
MIRT971089	hsa-miR-4504	CLIP-seq
MIRT1987697	hsa-miR-450b-5p	CLIP-seq
MIRT971090	hsa-miR-4514	CLIP-seq
MIRT971097	hsa-miR-4692	CLIP-seq
MIRT1987698	hsa-miR-4753-3p	CLIP-seq
MIRT1987699	hsa-miR-4768-5p	CLIP-seq
MIRT971105	hsa-miR-542-3p	CLIP-seq
MIRT1987700	hsa-miR-548g	CLIP-seq
MIRT971107	hsa-miR-563	CLIP-seq
MIRT2222110	hsa-miR-132	CLIP-seq
MIRT971070	hsa-miR-200b	CLIP-seq
MIRT971071	hsa-miR-200c	CLIP-seq
MIRT2222111	hsa-miR-212	CLIP-seq
MIRT2222112	hsa-miR-3120-3p	CLIP-seq
MIRT2222113	hsa-miR-3121-5p	CLIP-seq
MIRT2222114	hsa-miR-3134	CLIP-seq
MIRT2222115	hsa-miR-369-3p	CLIP-seq
MIRT971083	hsa-miR-4251	CLIP-seq
MIRT971086	hsa-miR-429	CLIP-seq
MIRT971089	hsa-miR-4504	CLIP-seq
MIRT2222116	hsa-miR-4534	CLIP-seq
MIRT971096	hsa-miR-4684-5p	CLIP-seq
MIRT971099	hsa-miR-4704-3p	CLIP-seq
MIRT1987698	hsa-miR-4753-3p	CLIP-seq
MIRT2222117	hsa-miR-4802-5p	CLIP-seq
MIRT2222118	hsa-miR-4803	CLIP-seq
MIRT2222119	hsa-miR-501-5p	CLIP-seq
MIRT971104	hsa-miR-539	CLIP-seq
MIRT971105	hsa-miR-542-3p	CLIP-seq
MIRT2222120	hsa-miR-561	CLIP-seq
MIRT971107	hsa-miR-563	CLIP-seq
MIRT2222121	hsa-miR-922	CLIP-seq
MIRT971072	hsa-miR-23a	CLIP-seq
MIRT971073	hsa-miR-23b	CLIP-seq
MIRT971074	hsa-miR-23c	CLIP-seq
MIRT2222112	hsa-miR-3120-3p	CLIP-seq
MIRT971083	hsa-miR-4251	CLIP-seq
MIRT2222122	hsa-miR-4270	CLIP-seq
MIRT2222123	hsa-miR-4441	CLIP-seq
MIRT1987697	hsa-miR-450b-5p	CLIP-seq
MIRT971101	hsa-miR-4795-3p	CLIP-seq
MIRT2437101	hsa-miR-3914	CLIP-seq
MIRT2437102	hsa-miR-4420	CLIP-seq
MIRT2437103	hsa-miR-4642	CLIP-seq
MIRT2437104	hsa-miR-4720-5p	CLIP-seq
MIRT2437105	hsa-miR-4799-3p	CLIP-seq
MIRT2437106	hsa-miR-656	CLIP-seq
MIRT2437107	hsa-miR-873	CLIP-seq
MIRT2437101	hsa-miR-3914	CLIP-seq
MIRT2437107	hsa-miR-873	CLIP-seq
MIRT2448965	hsa-miR-1294	CLIP-seq
MIRT2448966	hsa-miR-205	CLIP-seq
MIRT2448967	hsa-miR-3174	CLIP-seq
MIRT2448968	hsa-miR-3658	CLIP-seq
MIRT971088	hsa-miR-4426	CLIP-seq
MIRT971092	hsa-miR-4647	CLIP-seq
MIRT971094	hsa-miR-4662b	CLIP-seq
MIRT2448969	hsa-miR-548c-3p	CLIP-seq
MIRT2448970	hsa-miR-921	CLIP-seq
MIRT2448965	hsa-miR-1294	CLIP-seq
MIRT2448967	hsa-miR-3174	CLIP-seq
MIRT2448968	hsa-miR-3658	CLIP-seq
MIRT971088	hsa-miR-4426	CLIP-seq
MIRT971092	hsa-miR-4647	CLIP-seq
MIRT971094	hsa-miR-4662b	CLIP-seq
MIRT2448970	hsa-miR-921	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
NR0B1	Repression	16314306
SIRT1	Activation	19690166

Show/Hide all(20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0003707	Function	Steroid hormone receptor activity	IEA
GO:0004879	Function	Nuclear receptor activity	IBA	21873635
GO:0005496	Function	Steroid binding	IEA
GO:0005515	Function	Protein binding	IPI	10428842, 18063693, 19171140, 19914244, 25416956
GO:0005654	Component	Nucleoplasm	TAS
GO:0006355	Process	Regulation of transcription, DNA-templated	IDA	23836911
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0006367	Process	Transcription initiation from RNA polymerase II promoter	TAS
GO:0008270	Function	Zinc ion binding	IEA
GO:0043401	Process	Steroid hormone mediated signaling pathway	IEA
GO:0045893	Process	Positive regulation of transcription, DNA-templated	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048384	Process	Retinoic acid receptor signaling pathway	IEA
GO:0050682	Function	AF-2 domain binding	ISS
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	17229846
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
602969	3474	ENSG00000196482

Protein

UniProt ID

P62508

Protein name

Estrogen-related receptor gamma (ERR gamma-2) (Estrogen receptor-related protein 3) (Nuclear receptor subfamily 3 group B member 3)

Protein function

Orphan receptor that acts as a transcription activator in the absence of bound ligand. Binds specifically to an estrogen response element and activates reporter genes controlled by estrogen response elements (By similarity). Induces the expressi

PDB

1KV6 , 1TFC , 1VJB , 2E2R , 2EWP , 2GP7 , 2GPO , 2GPP , 2GPU , 2GPV , 2P7A , 2P7G , 2P7Z , 2ZAS , 2ZBS , 2ZKC , 5YSO , 6A6K , 6I61 , 6I62 , 6I63 , 6I64 , 6I65 , 6I66 , 6I67 , 6K3N , 6KNR , 6XXC , 6XY5 , 6Y18 , 6Y1D , 6Y3W , 6Y58 , 8B4Q , 8BJG , 8BJN , 8BM5 , 8IFO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00105	zf-C4	126 → 195	Zinc finger, C4 type (two domains)	Domain
PF00104	Hormone_recep	255 → 441	Ligand-binding domain of nuclear hormone receptor	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in the heart, kidney, brain, lung, bone marrow, adrenal gland, trachea, spinal cord and thyroid gland. {ECO:0000269|PubMed:14651967, ECO:0000269|PubMed:9676434}.

Sequence

MDSVELCLPESFSLHYEEELLCRMSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGG
SSDASGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYML
NSMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSC
QACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKPYNKIVSH
LLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSL
LQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMK
LEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMT
LPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV

Sequence length

458

Interactions

View interactions

	Reactome
			Nuclear Receptor transcription pathway

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Breast carcinoma	Breast Carcinoma	rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451 View all (71 more)	29059683

Show/Hide Unknown Diseases (8)

Disease term	Disease name	Evidence	References	Source
Unknown
Mental depression	Major Depressive Disorder		29071344	ClinVar
Mental Depression	Mental Depression			GWAS
Intracranial Aneurysm	Intracranial Aneurysm			GWAS
Breast Cancer	Breast Cancer	Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients		GWAS, CBGDA
Tremor	Tremor			GWAS
Astrocytoma	Astrocytoma			GWAS
Dyslexia	Dyslexia			GWAS
Atrial Fibrillation	Atrial Fibrillation			GWAS

Show/Hide Text Mining Associations (41)

Disease Name	Relationship Type	References
Associations from Text Mining
Breast Neoplasms	Associate	18974135, 20889127, 23977052, 24684682, 25971350, 29940916, 35092367
Carcinogenesis	Associate	16681769, 26940882
Carcinogenesis	Inhibit	37679788
Carcinoma Hepatocellular	Associate	25940592
Carcinoma Hepatocellular	Stimulate	26940882
Carcinoma Renal Cell	Associate	27128972, 30131446
Cardiomyopathy Hypertrophic	Associate	37802074
Coronary Disease	Associate	34883250
Developmental Disabilities	Associate	27381092
Diabetes Mellitus Type 2	Associate	34883250
Endometrial Neoplasms	Associate	16681769, 23051957
Endometriosis	Inhibit	39678195
Esophageal Squamous Cell Carcinoma	Inhibit	37679788
Fetal Growth Retardation	Inhibit	26051094, 35594451
Fetal Growth Retardation	Associate	39199376
Hearing Loss	Associate	27381092
Heart Diseases	Associate	19471316
Heart Failure	Associate	35418170
Hypoxia	Stimulate	23050013, 35594451
Hypoxia	Associate	36787804
Liver Cirrhosis Biliary	Associate	24687322
Lymphatic Metastasis	Stimulate	26940882
Migraine Disorders	Associate	34380431
Neoplasm Metastasis	Inhibit	16681769
Neoplasm Metastasis	Associate	25971350, 37653798
Neoplasms	Associate	19822186, 26940882, 32571331
Neoplasms	Inhibit	20128821, 31002184
Obesity	Associate	11705994, 27113491
Osteoporosis	Associate	19821770
Ovarian Neoplasms	Associate	34089362
Placenta Diseases	Associate	35594451
Pre Eclampsia	Associate	26051094
Primary Ovarian Insufficiency	Associate	31692519
Prolactinoma	Associate	32427851
Prostatic Neoplasms	Associate	20128821
Pulmonary Edema	Associate	34883250
Squamous Cell Carcinoma of Head and Neck	Associate	31002184, 35794182
Stiff Skin Syndrome	Associate	28852080
Stomach Neoplasms	Associate	32571331, 37653798
Triple Negative Breast Neoplasms	Associate	27038254
Weight Loss	Associate	34883250

ESRRG (estrogen related receptor gamma)