Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2104
Gene name Gene Name - the full gene name approved by the HGNC.
Estrogen related receptor gamma
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ESRRG
Synonyms (NCBI Gene) Gene synonyms aliases
ERR-gamma, ERR3, ERRg, ERRgamma, NR3B3
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q41
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the estrogen receptor-related receptor (ESRR) family, which belongs to the nuclear hormone receptor superfamily. All members of the ESRR family share an almost identical DNA binding domain, which is composed of two C4-type zi
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT437839 hsa-miR-205-5p Luciferase reporter assay 23589079
MIRT437839 hsa-miR-205-5p Luciferase reporter assay 23589079
MIRT668525 hsa-miR-935 HITS-CLIP 23824327
MIRT668524 hsa-miR-6515-3p HITS-CLIP 23824327
MIRT668523 hsa-miR-1236-3p HITS-CLIP 23824327
Transcription factors
Transcription factor Regulation Reference
NR0B1 Repression 16314306
SIRT1 Activation 19690166
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin IBA
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602969 3474 ENSG00000196482
Protein
UniProt ID P62508
Protein name Estrogen-related receptor gamma (ERR gamma-2) (Estrogen receptor-related protein 3) (Nuclear receptor subfamily 3 group B member 3)
Protein function Orphan receptor that acts as a transcription activator in the absence of bound ligand. Binds specifically to an estrogen response element and activates reporter genes controlled by estrogen response elements (By similarity). Induces the expressi
PDB 1KV6 , 1TFC , 1VJB , 2E2R , 2EWP , 2GP7 , 2GPO , 2GPP , 2GPU , 2GPV , 2P7A , 2P7G , 2P7Z , 2ZAS , 2ZBS , 2ZKC , 5YSO , 6A6K , 6I61 , 6I62 , 6I63 , 6I64 , 6I65 , 6I66 , 6I67 , 6K3N , 6KNR , 6XXC , 6XY5 , 6Y18 , 6Y1D , 6Y3W , 6Y58 , 8B4Q , 8BJG , 8BJN , 8BM5 , 8IFO
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00105 zf-C4 126 195 Zinc finger, C4 type (two domains) Domain
PF00104 Hormone_recep 255 441 Ligand-binding domain of nuclear hormone receptor Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in the heart, kidney, brain, lung, bone marrow, adrenal gland, trachea, spinal cord and thyroid gland. {ECO:0000269|PubMed:14651967, ECO:0000269|PubMed:9676434}.
Sequence
MDSVELCLPESFSLHYEEELLCRMSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGG
SSDASGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYML
NSMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSC
QACRFMKCLKVGMLK
EGVRLDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKPYNKIVSH
LLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSL
LQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMK
LEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMT
LPLLRQTSTKAVQHFYNIKLE
GKVPMHKLFLEMLEAKV
Sequence length 458
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Nuclear Receptor transcription pathway
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Astrocytoma Pilocytic astrocytoma N/A N/A GWAS
Atrial Fibrillation Atrial fibrillation N/A N/A GWAS
Breast Cancer Breast cancer N/A N/A GWAS
Dyslexia Dyslexia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 18974135, 20889127, 23977052, 24684682, 25971350, 29940916, 35092367
Carcinogenesis Associate 16681769, 26940882
Carcinogenesis Inhibit 37679788
Carcinoma Hepatocellular Associate 25940592
Carcinoma Hepatocellular Stimulate 26940882
Carcinoma Renal Cell Associate 27128972, 30131446
Cardiomyopathy Hypertrophic Associate 37802074
Coronary Disease Associate 34883250
Developmental Disabilities Associate 27381092
Diabetes Mellitus Type 2 Associate 34883250