Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2103
Gene name Gene Name - the full gene name approved by the HGNC.
Estrogen related receptor beta
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ESRRB
Synonyms (NCBI Gene) Gene synonyms aliases
DFNB35, ERR beta-2, ERR2, ERRb, ERRbeta2, ESRL2, NR3B2
Disease Acronyms (UniProt) Disease acronyms from UniProt database
DFNB35
Chromosome Chromosome number
14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
14q24.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein with similarity to the estrogen receptor. Its function is unknown; however, a similar protein in mouse plays an essential role in placental development. [provided by RefSeq, Jul 2008]
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs121909110 C>T Pathogenic Missense variant, coding sequence variant, non coding transcript variant
rs121909111 G>T Pathogenic Missense variant, coding sequence variant, non coding transcript variant
rs188462546 T>C Conflicting-interpretations-of-pathogenicity, uncertain-significance Coding sequence variant, non coding transcript variant, 3 prime UTR variant, missense variant
rs202023138 C>A,T Likely-pathogenic Coding sequence variant, synonymous variant, non coding transcript variant, stop gained
rs375916159 G>A,T Pathogenic Coding sequence variant, non coding transcript variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017698 hsa-miR-335-5p Microarray 18185580
MIRT437524 hsa-miR-19b-3p Immunoprecipitaion 22382630
MIRT527878 hsa-miR-6768-5p PAR-CLIP 22012620
MIRT527877 hsa-miR-552-3p PAR-CLIP 22012620
MIRT527876 hsa-miR-4695-5p PAR-CLIP 22012620
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000793 Component Condensed chromosome ISS
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding ISS
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602167 3473 ENSG00000119715
Protein
UniProt ID O95718
Protein name Steroid hormone receptor ERR2 (ERR beta-2) (Estrogen receptor-like 2) (Estrogen-related receptor beta) (ERR-beta) (Nuclear receptor subfamily 3 group B member 2)
Protein function [Isoform 3]: Transcription factor that binds a canonical ESRRB recognition (ERRE) sequence 5'TCAAGGTCA-3' localized on promoter and enhancer of targets genes regulating their expression or their transcription activity (PubMed:17920186, PubMed:19
PDB 1LO1 , 6LIT , 6LN4
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00105 zf-C4 101 170 Zinc finger, C4 type (two domains) Domain
PF00104 Hormone_recep 236 416 Ligand-binding domain of nuclear hormone receptor Domain
Sequence
MSSDDRHLGSSCGSFIKTEPSSPSSGIDALSHHSPSGSSDASGGFGLALGTHANGLDSPP
MFAGAGLGGTPCRKSYEDCASGIMEDSAIKCEYMLNAIPKRLCLVCGDIASGYHYGVASC
EACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLK
EGVRLDRVRG
GRQKYKRRLDSESSPYLSLQISPPAKKPLTKIVSYLLVAEPDKLYAMPPPGMPEGDIKAL
TTLCDLADRELVVIIGWAKHIPGFSSLSLGDQMSLLQSAWMEILILGIVYRSLPYDDKLV
YAEDYIMDEEHSRLAGLLELYRAILQLVRRYKKLKVEKEEFVTLKALALANSDSMYIEDL
EAVQKLQDLLHEALQDYELSQRHEEPWRTGKLLLTLPLLRQTAAKAVQHFYSVKLQ
GKVP
MHKLFLEMLEAKV
Sequence length 433
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Signaling pathways regulating pluripotency of stem cells   Nuclear Receptor transcription pathway
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Deafness DEAFNESS, AUTOSOMAL RECESSIVE 35 rs267607135, rs387906219, rs387906220, rs387906221, rs387906222, rs606231120, rs267606855, rs121918370, rs137853185, rs137853186, rs137853187, rs137853188, rs587776522, rs587776523, rs200781822
View all (1019 more)
9344655, 18179891
Hearing loss Sensorineural Hearing Loss (disorder) rs267607135, rs267606855, rs779841884, rs267606854, rs28942097, rs121908073, rs121908076, rs74315289, rs121908144, rs111033313, rs74315437, rs121908348, rs121908349, rs121908350, rs397515359
View all (184 more)
Nonsyndromic deafness Nonsyndromic Deafness rs606231410, rs794729665, rs730880338, rs1566538321 21802533, 25342930, 18179891, 22567352, 17765677, 22951369
Unknown
Disease term Disease name Evidence References Source
Astrocytoma Astrocytoma GWAS
Associations from Text Mining
Disease Name Relationship Type References
Bicuspid Aortic Valve Disease Associate 36071494
Breast Neoplasms Associate 22359603, 24667650, 27363015, 29843638, 29940916, 32168782, 35092367, 37350664
Breast Neoplasms Inhibit 31741180, 32839427
Deafness Associate 15958501, 31741180
Deafness Autosomal Recessive 35 Associate 18179891
Diabetes Mellitus Associate 19682370
Endometriosis Inhibit 39678195
Hearing Loss Associate 25938503, 31835641, 32681043, 33524517, 34194829, 35101039, 39261511
Hearing Loss Noise Induced Associate 27399974
Hypoxia Stimulate 23050013