Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2077
Gene name Gene Name - the full gene name approved by the HGNC.	ETS2 repressor factor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ERF
Synonyms (NCBI Gene) Gene synonyms aliases	CHYTS, CRS4, PE-2, PE2
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.2
Summary Summary of gene provided in NCBI Entrez Gene.	ETS2 is a transcription factor and protooncogene involved in development, apoptosis, and the regulation of telomerase. The protein encoded by this gene binds to the ETS2 promoter and is a strong repressor of ETS2 transcription. Several transcript variants

Show/Hide all(21)

SNP ID	Visualize variation	Clinical significance	Consequence
rs587777006	G>A,C	Pathogenic	Stop gained, coding sequence variant, missense variant
rs587777007	CT>-	Likely-pathogenic, pathogenic	Frameshift variant, coding sequence variant
rs587777008	G>A	Pathogenic	Coding sequence variant, missense variant
rs587777009	C>A,T	Pathogenic	5 prime UTR variant, coding sequence variant, missense variant
rs587777010	G>A	Pathogenic	Stop gained, coding sequence variant
rs864321680	T>C	Pathogenic	Splice acceptor variant
rs864321681	T>C	Pathogenic	Missense variant, intron variant, upstream transcript variant, genic upstream transcript variant, initiator codon variant
rs886041001	T>C	Pathogenic	Missense variant, coding sequence variant
rs1064794325	TT>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1064796715	GG>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1555750642	C>-	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1555750721	G>-	Pathogenic	Frameshift variant, coding sequence variant
rs1555750741	G>-	Pathogenic	Frameshift variant, coding sequence variant
rs1555750795	G>A	Pathogenic	Coding sequence variant, stop gained
rs1555750816	CA>-	Pathogenic	Coding sequence variant, stop gained
rs1568472223	GGCGGGGCACT>-	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1568472771	G>A	Pathogenic	Coding sequence variant, stop gained, 5 prime UTR variant
rs1568475667	CCCCCACCTGTGTCCGCCGGGGTCTTCATGCTGGGGGGCCCGGGGCGAAGCGCCCCGATTCCGGGCCGCGGCTCCCG>-	Pathogenic	5 prime UTR variant, upstream transcript variant, initiator codon variant, genic upstream transcript variant, splice donor variant, intron variant
rs1599820741	C>-	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1599823350	T>A	Likely-pathogenic	Coding sequence variant, stop gained
rs1599824091	C>T	Likely-pathogenic	Coding sequence variant, missense variant, initiator codon variant

Show/Hide all(209)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022909	hsa-miR-124-3p	Microarray	18668037
MIRT037283	hsa-miR-877-5p	CLASH	23622248
MIRT035783	hsa-miR-1914-5p	CLASH	23622248
MIRT968659	hsa-miR-1207-3p	CLIP-seq
MIRT968660	hsa-miR-124	CLIP-seq
MIRT968661	hsa-miR-1321	CLIP-seq
MIRT968662	hsa-miR-181a	CLIP-seq
MIRT968663	hsa-miR-181b	CLIP-seq
MIRT968664	hsa-miR-181c	CLIP-seq
MIRT968665	hsa-miR-181d	CLIP-seq
MIRT968666	hsa-miR-1827	CLIP-seq
MIRT968667	hsa-miR-1910	CLIP-seq
MIRT968668	hsa-miR-2052	CLIP-seq
MIRT968669	hsa-miR-22	CLIP-seq
MIRT968670	hsa-miR-28-5p	CLIP-seq
MIRT968671	hsa-miR-299-3p	CLIP-seq
MIRT968672	hsa-miR-300	CLIP-seq
MIRT968673	hsa-miR-3127-3p	CLIP-seq
MIRT968674	hsa-miR-3127-5p	CLIP-seq
MIRT968675	hsa-miR-3139	CLIP-seq
MIRT968676	hsa-miR-3150a-3p	CLIP-seq
MIRT968677	hsa-miR-3151	CLIP-seq
MIRT968678	hsa-miR-3175	CLIP-seq
MIRT968679	hsa-miR-3179	CLIP-seq
MIRT968680	hsa-miR-3192	CLIP-seq
MIRT968681	hsa-miR-3656	CLIP-seq
MIRT968682	hsa-miR-3682-5p	CLIP-seq
MIRT968683	hsa-miR-3714	CLIP-seq
MIRT968684	hsa-miR-381	CLIP-seq
MIRT968685	hsa-miR-3910	CLIP-seq
MIRT968686	hsa-miR-3918	CLIP-seq
MIRT968687	hsa-miR-3919	CLIP-seq
MIRT968688	hsa-miR-3925-3p	CLIP-seq
MIRT968689	hsa-miR-3925-5p	CLIP-seq
MIRT968690	hsa-miR-3936	CLIP-seq
MIRT968691	hsa-miR-3945	CLIP-seq
MIRT968692	hsa-miR-4257	CLIP-seq
MIRT968693	hsa-miR-4262	CLIP-seq
MIRT968694	hsa-miR-4270	CLIP-seq
MIRT968695	hsa-miR-4278	CLIP-seq
MIRT968696	hsa-miR-4290	CLIP-seq
MIRT968697	hsa-miR-4419a	CLIP-seq
MIRT968698	hsa-miR-4441	CLIP-seq
MIRT968699	hsa-miR-4446-3p	CLIP-seq
MIRT968700	hsa-miR-4447	CLIP-seq
MIRT968701	hsa-miR-4450	CLIP-seq
MIRT968702	hsa-miR-4472	CLIP-seq
MIRT968703	hsa-miR-4481	CLIP-seq
MIRT968704	hsa-miR-4492	CLIP-seq
MIRT968705	hsa-miR-4498	CLIP-seq
MIRT968706	hsa-miR-4505	CLIP-seq
MIRT968707	hsa-miR-4510	CLIP-seq
MIRT968708	hsa-miR-4535	CLIP-seq
MIRT968709	hsa-miR-4640-3p	CLIP-seq
MIRT968710	hsa-miR-4640-5p	CLIP-seq
MIRT968711	hsa-miR-4641	CLIP-seq
MIRT968712	hsa-miR-4666-3p	CLIP-seq
MIRT968713	hsa-miR-4667-5p	CLIP-seq
MIRT968714	hsa-miR-4668-5p	CLIP-seq
MIRT968715	hsa-miR-4685-5p	CLIP-seq
MIRT968716	hsa-miR-4698	CLIP-seq
MIRT968717	hsa-miR-4700-5p	CLIP-seq
MIRT968718	hsa-miR-4716-3p	CLIP-seq
MIRT968719	hsa-miR-4720-3p	CLIP-seq
MIRT968720	hsa-miR-4726-5p	CLIP-seq
MIRT968721	hsa-miR-4728-5p	CLIP-seq
MIRT968722	hsa-miR-4731-5p	CLIP-seq
MIRT968723	hsa-miR-4738-5p	CLIP-seq
MIRT968724	hsa-miR-4739	CLIP-seq
MIRT968725	hsa-miR-4745-5p	CLIP-seq
MIRT968726	hsa-miR-4749-3p	CLIP-seq
MIRT968727	hsa-miR-4756-5p	CLIP-seq
MIRT968728	hsa-miR-4761-3p	CLIP-seq
MIRT968729	hsa-miR-4763-5p	CLIP-seq
MIRT968730	hsa-miR-4773	CLIP-seq
MIRT968731	hsa-miR-4776-5p	CLIP-seq
MIRT968732	hsa-miR-4789-5p	CLIP-seq
MIRT968733	hsa-miR-486-3p	CLIP-seq
MIRT968734	hsa-miR-491-5p	CLIP-seq
MIRT968735	hsa-miR-506	CLIP-seq
MIRT968736	hsa-miR-515-5p	CLIP-seq
MIRT968737	hsa-miR-545	CLIP-seq
MIRT968738	hsa-miR-548p	CLIP-seq
MIRT968739	hsa-miR-558	CLIP-seq
MIRT968740	hsa-miR-561	CLIP-seq
MIRT968741	hsa-miR-646	CLIP-seq
MIRT968742	hsa-miR-708	CLIP-seq
MIRT968743	hsa-miR-762	CLIP-seq
MIRT968744	hsa-miR-766	CLIP-seq
MIRT968745	hsa-miR-939	CLIP-seq
MIRT968659	hsa-miR-1207-3p	CLIP-seq
MIRT1987099	hsa-miR-1207-5p	CLIP-seq
MIRT968660	hsa-miR-124	CLIP-seq
MIRT1987100	hsa-miR-1250	CLIP-seq
MIRT968661	hsa-miR-1321	CLIP-seq
MIRT968666	hsa-miR-1827	CLIP-seq
MIRT968667	hsa-miR-1910	CLIP-seq
MIRT1987101	hsa-miR-2054	CLIP-seq
MIRT968669	hsa-miR-22	CLIP-seq
MIRT968670	hsa-miR-28-5p	CLIP-seq
MIRT968675	hsa-miR-3139	CLIP-seq
MIRT968676	hsa-miR-3150a-3p	CLIP-seq
MIRT1987102	hsa-miR-3150b-3p	CLIP-seq
MIRT968678	hsa-miR-3175	CLIP-seq
MIRT968680	hsa-miR-3192	CLIP-seq
MIRT1987103	hsa-miR-342-5p	CLIP-seq
MIRT1987104	hsa-miR-3612	CLIP-seq
MIRT1987105	hsa-miR-3620	CLIP-seq
MIRT1987106	hsa-miR-3671	CLIP-seq
MIRT1987107	hsa-miR-3674	CLIP-seq
MIRT968683	hsa-miR-3714	CLIP-seq
MIRT968685	hsa-miR-3910	CLIP-seq
MIRT968690	hsa-miR-3936	CLIP-seq
MIRT968691	hsa-miR-3945	CLIP-seq
MIRT1987108	hsa-miR-4269	CLIP-seq
MIRT968695	hsa-miR-4278	CLIP-seq
MIRT1987109	hsa-miR-4283	CLIP-seq
MIRT968696	hsa-miR-4290	CLIP-seq
MIRT968699	hsa-miR-4446-3p	CLIP-seq
MIRT968701	hsa-miR-4450	CLIP-seq
MIRT968703	hsa-miR-4481	CLIP-seq
MIRT1987110	hsa-miR-4489	CLIP-seq
MIRT968704	hsa-miR-4492	CLIP-seq
MIRT968705	hsa-miR-4498	CLIP-seq
MIRT968706	hsa-miR-4505	CLIP-seq
MIRT968708	hsa-miR-4535	CLIP-seq
MIRT968710	hsa-miR-4640-5p	CLIP-seq
MIRT968711	hsa-miR-4641	CLIP-seq
MIRT1987111	hsa-miR-4651	CLIP-seq
MIRT1987112	hsa-miR-4656	CLIP-seq
MIRT1987113	hsa-miR-4664-5p	CLIP-seq
MIRT1987114	hsa-miR-4667-3p	CLIP-seq
MIRT968713	hsa-miR-4667-5p	CLIP-seq
MIRT968715	hsa-miR-4685-5p	CLIP-seq
MIRT1987115	hsa-miR-4689	CLIP-seq
MIRT1987116	hsa-miR-4690-5p	CLIP-seq
MIRT968717	hsa-miR-4700-5p	CLIP-seq
MIRT968718	hsa-miR-4716-3p	CLIP-seq
MIRT968719	hsa-miR-4720-3p	CLIP-seq
MIRT1987117	hsa-miR-4721	CLIP-seq
MIRT968720	hsa-miR-4726-5p	CLIP-seq
MIRT968721	hsa-miR-4728-5p	CLIP-seq
MIRT968722	hsa-miR-4731-5p	CLIP-seq
MIRT1987118	hsa-miR-4732-5p	CLIP-seq
MIRT968724	hsa-miR-4739	CLIP-seq
MIRT968725	hsa-miR-4745-5p	CLIP-seq
MIRT968727	hsa-miR-4756-5p	CLIP-seq
MIRT968728	hsa-miR-4761-3p	CLIP-seq
MIRT1987119	hsa-miR-4763-3p	CLIP-seq
MIRT968729	hsa-miR-4763-5p	CLIP-seq
MIRT968731	hsa-miR-4776-5p	CLIP-seq
MIRT1987120	hsa-miR-4779	CLIP-seq
MIRT1987121	hsa-miR-4784	CLIP-seq
MIRT968734	hsa-miR-491-5p	CLIP-seq
MIRT968735	hsa-miR-506	CLIP-seq
MIRT1987122	hsa-miR-508-3p	CLIP-seq
MIRT968737	hsa-miR-545	CLIP-seq
MIRT968738	hsa-miR-548p	CLIP-seq
MIRT968739	hsa-miR-558	CLIP-seq
MIRT1987123	hsa-miR-607	CLIP-seq
MIRT1987124	hsa-miR-608	CLIP-seq
MIRT968741	hsa-miR-646	CLIP-seq
MIRT1987125	hsa-miR-650	CLIP-seq
MIRT968742	hsa-miR-708	CLIP-seq
MIRT968743	hsa-miR-762	CLIP-seq
MIRT968745	hsa-miR-939	CLIP-seq
MIRT1987126	hsa-miR-940	CLIP-seq
MIRT2221509	hsa-miR-1285	CLIP-seq
MIRT2221510	hsa-miR-129-3p	CLIP-seq
MIRT2221511	hsa-miR-140-3p	CLIP-seq
MIRT2221512	hsa-miR-145	CLIP-seq
MIRT2221513	hsa-miR-1470	CLIP-seq
MIRT968662	hsa-miR-181a	CLIP-seq
MIRT968663	hsa-miR-181b	CLIP-seq
MIRT968664	hsa-miR-181c	CLIP-seq
MIRT968665	hsa-miR-181d	CLIP-seq
MIRT968666	hsa-miR-1827	CLIP-seq
MIRT968667	hsa-miR-1910	CLIP-seq
MIRT968673	hsa-miR-3127-3p	CLIP-seq
MIRT968674	hsa-miR-3127-5p	CLIP-seq
MIRT2221514	hsa-miR-3162-3p	CLIP-seq
MIRT2221515	hsa-miR-3187-5p	CLIP-seq
MIRT2221516	hsa-miR-323b-3p	CLIP-seq
MIRT968681	hsa-miR-3656	CLIP-seq
MIRT2221517	hsa-miR-3679-3p	CLIP-seq
MIRT968686	hsa-miR-3918	CLIP-seq
MIRT968688	hsa-miR-3925-3p	CLIP-seq
MIRT2221518	hsa-miR-3943	CLIP-seq
MIRT968692	hsa-miR-4257	CLIP-seq
MIRT968693	hsa-miR-4262	CLIP-seq
MIRT2221519	hsa-miR-4264	CLIP-seq
MIRT2221520	hsa-miR-4292	CLIP-seq
MIRT2221521	hsa-miR-4469	CLIP-seq
MIRT968703	hsa-miR-4481	CLIP-seq
MIRT2221522	hsa-miR-455-3p	CLIP-seq
MIRT968709	hsa-miR-4640-3p	CLIP-seq
MIRT1987114	hsa-miR-4667-3p	CLIP-seq
MIRT2221523	hsa-miR-4687-5p	CLIP-seq
MIRT968723	hsa-miR-4738-5p	CLIP-seq
MIRT968725	hsa-miR-4745-5p	CLIP-seq
MIRT968726	hsa-miR-4749-3p	CLIP-seq
MIRT968733	hsa-miR-486-3p	CLIP-seq
MIRT968736	hsa-miR-515-5p	CLIP-seq
MIRT2221524	hsa-miR-612	CLIP-seq
MIRT2221525	hsa-miR-659	CLIP-seq
MIRT968744	hsa-miR-766	CLIP-seq
MIRT2221518	hsa-miR-3943	CLIP-seq
MIRT1987099	hsa-miR-1207-5p	CLIP-seq
MIRT1987119	hsa-miR-4763-3p	CLIP-seq

Show/Hide all(21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	7588608
GO:0000785	Component	Chromatin	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	7588608
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0030154	Process	Cell differentiation	IBA
GO:0043565	Function	Sequence-specific DNA binding	IDA	23332764
GO:0043565	Function	Sequence-specific DNA binding	IEA

MIM	HGNC	e!Ensembl
611888	3444	ENSG00000105722

Protein

UniProt ID

P50548

Protein name

ETS domain-containing transcription factor ERF (Ets2 repressor factor) (PE-2)

Protein function

Potent transcriptional repressor that binds to the H1 element of the Ets2 promoter. May regulate other genes involved in cellular proliferation. Required for extraembryonic ectoderm differentiation, ectoplacental cone cavity closure, and chorioa

PDB

7JSA , 7JSL

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00178	Ets	28 → 107	Ets-domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highest levels in testis, ovary, pancreas, and heart. {ECO:0000269|PubMed:9192842}.

Sequence

MKTPADTGFAFPDWAYKPESSPGSRQIQLWHFILELLRKEEYQGVIAWQGDYGEFVIKDP
DEVARLWGVRKCKPQMNYDKLSRALRYYYNKRILHKTKGKRFTYKFNFNKLVLVNYPFID
VGLAGGAVPQSAPPVPSGGSHFRFPPSTPSEVLSPTEDPRSPPACSSSSSSLFSAVVARR
LGRGSVSDCSDGTSELEEPLGEDPRARPPGPPDLGAFRGPPLARLPHDPGVFRVYPRPRG
GPEPLSPFPVSPLAGPGSLLPPQLSPALPMTPTHLAYTPSPTLSPMYPSGGGGPSGSGGG
SHFSFSPEDMKRYLQAHTQSVYNYHLSPRAFLHYPGLVVPQPQRPDKCPLPPMAPETPPV
PSSASSSSSSSSSPFKFKLQPPPLGRRQRAAGEKAVAGADKSGGSAGGLAEGAGALAPPP
PPPQIKVEPISEGESEEVEVTDISDEDEEDGEVFKTPRAPPAPPKPEPGEAPGASQCMPL
KLRFKRRWSEDCRLEGGGGPAGGFEDEGEDKKVRGEGPGEAGGPLTPRRVSSDLQHATAQ
LSLEHRDS

Sequence length

548

Interactions

View interactions

	Reactome
			Oncogene Induced Senescence

Show/Hide Causal Diseases (1)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Craniosynostosis	craniosynostosis 4	rs587777007, rs587777008, rs587777010, rs864321680, rs864321681, rs1064794325, rs1555750816, rs1599823350, rs587777006	N/A

Show/Hide Unknown Diseases (4)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
craniosynostosis syndrome	Craniosynostosis syndrome	N/A	N/A	ClinVar
Crouzon Disease	Crouzon syndrome	N/A	N/A	GenCC
Multiple myeloma	multiple myeloma	N/A	N/A	ClinVar
Scaphocephaly	isolated scaphocephaly	N/A	N/A	GenCC

Show/Hide Text Mining Associations (20)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Apraxias	Associate	30758909
Arnold Chiari Malformation	Associate	30758909
beta Thalassemia	Associate	38218889
Bronchomalacia	Associate	27738187
Cranial Nerve Diseases	Associate	34117072
Craniosynostoses	Associate	27738187, 30758909, 32370745, 34117072
Developmental Disabilities	Associate	34117072
Facial Dysmorphism with Multiple Malformations	Associate	30758909
Hallux Valgus	Associate	27738187
Hand Injuries	Associate	32592542
Heart defects limb shortening	Associate	32592542
Intracranial Hypertension	Associate	32370745
Learning Disabilities	Associate	30758909
Leukemia	Associate	38549229
Mental Disorders	Associate	30758909
Neoplasms	Associate	35952322, 36383412
Prostatic Neoplasms	Inhibit	36383412
Prostatitis	Associate	28750683
Prostatitis	Inhibit	36383412
Sarcoma Ewing	Associate	35952322

ERF (ETS2 repressor factor)