Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2043
Gene name Gene Name - the full gene name approved by the HGNC.	EPH receptor A4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	EPHA4
Synonyms (NCBI Gene) Gene synonyms aliases	EK8, HEK8, SEK, TYRO1
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q36.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically ha

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1553568456	C>T	Likely-pathogenic	Coding sequence variant, missense variant

Show/Hide all(769)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006972	hsa-miR-10a-5p	GFP reporter assay, Immunohistochemistry, qRT-PCR, Western blot	22996586
MIRT006972	hsa-miR-10a-5p	GFP reporter assay, Immunohistochemistry, qRT-PCR, Western blot	22996586
MIRT016908	hsa-miR-335-5p	Microarray	18185580
MIRT020126	hsa-miR-130b-3p	Sequencing	20371350
MIRT021734	hsa-miR-132-3p	Microarray	17612493
MIRT027959	hsa-miR-93-5p	Sequencing	20371350
MIRT030703	hsa-miR-21-5p	Microarray	18591254
MIRT049304	hsa-miR-92a-3p	CLASH	23622248
MIRT027959	hsa-miR-93-5p	CLASH	23622248
MIRT006972	hsa-miR-10a-5p	CLASH	23622248
MIRT047479	hsa-miR-10b-5p	CLASH	23622248
MIRT044406	hsa-miR-320a	CLASH	23622248
MIRT044104	hsa-miR-361-5p	CLASH	23622248
MIRT041039	hsa-miR-505-3p	CLASH	23622248
MIRT711424	hsa-miR-1911-3p	HITS-CLIP	19536157
MIRT711423	hsa-miR-4733-3p	HITS-CLIP	19536157
MIRT711422	hsa-miR-3937	HITS-CLIP	19536157
MIRT711421	hsa-miR-597-5p	HITS-CLIP	19536157
MIRT711420	hsa-miR-592	HITS-CLIP	19536157
MIRT711424	hsa-miR-1911-3p	HITS-CLIP	19536157
MIRT711423	hsa-miR-4733-3p	HITS-CLIP	19536157
MIRT711422	hsa-miR-3937	HITS-CLIP	19536157
MIRT711421	hsa-miR-597-5p	HITS-CLIP	19536157
MIRT711420	hsa-miR-592	HITS-CLIP	19536157
MIRT711424	hsa-miR-1911-3p	HITS-CLIP	19536157
MIRT711423	hsa-miR-4733-3p	HITS-CLIP	19536157
MIRT711422	hsa-miR-3937	HITS-CLIP	19536157
MIRT711421	hsa-miR-597-5p	HITS-CLIP	19536157
MIRT711420	hsa-miR-592	HITS-CLIP	19536157
MIRT638763	hsa-miR-605-5p	HITS-CLIP	23824327
MIRT638762	hsa-miR-4645-5p	HITS-CLIP	23824327
MIRT638761	hsa-miR-4673	HITS-CLIP	23824327
MIRT638760	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT638759	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT638758	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT638757	hsa-miR-623	HITS-CLIP	23824327
MIRT638756	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT638755	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT638754	hsa-miR-3180-5p	HITS-CLIP	23824327
MIRT638753	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT638752	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT638751	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT548352	hsa-miR-98-5p	PAR-CLIP	21572407
MIRT548351	hsa-let-7e-5p	PAR-CLIP	21572407
MIRT548350	hsa-let-7a-5p	PAR-CLIP	21572407
MIRT548349	hsa-let-7g-5p	PAR-CLIP	21572407
MIRT548347	hsa-miR-4458	PAR-CLIP	21572407
MIRT548348	hsa-let-7f-5p	PAR-CLIP	21572407
MIRT548346	hsa-let-7d-5p	PAR-CLIP	21572407
MIRT548345	hsa-let-7i-5p	PAR-CLIP	21572407
MIRT548344	hsa-let-7c-5p	PAR-CLIP	21572407
MIRT548342	hsa-miR-4500	PAR-CLIP	21572407
MIRT548343	hsa-let-7b-5p	PAR-CLIP	21572407
MIRT548340	hsa-miR-7844-5p	PAR-CLIP	21572407
MIRT548341	hsa-miR-3609	PAR-CLIP	21572407
MIRT548339	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT548338	hsa-miR-4796-3p	PAR-CLIP	21572407
MIRT548337	hsa-miR-3129-3p	PAR-CLIP	21572407
MIRT548336	hsa-miR-5583-5p	PAR-CLIP	21572407
MIRT016908	hsa-miR-335-5p	PAR-CLIP	21572407
MIRT548334	hsa-miR-4275	PAR-CLIP	21572407
MIRT548335	hsa-miR-490-5p	PAR-CLIP	21572407
MIRT548332	hsa-miR-676-5p	PAR-CLIP	21572407
MIRT548331	hsa-miR-202-3p	PAR-CLIP	21572407
MIRT548330	hsa-miR-6744-5p	PAR-CLIP	21572407
MIRT548329	hsa-miR-1255a	PAR-CLIP	21572407
MIRT548328	hsa-miR-1255b-5p	PAR-CLIP	21572407
MIRT548309	hsa-miR-22-5p	PAR-CLIP	21572407
MIRT548327	hsa-miR-5011-3p	PAR-CLIP	21572407
MIRT558081	hsa-miR-498	PAR-CLIP	21572407
MIRT548352	hsa-miR-98-5p	PAR-CLIP	21572407
MIRT548351	hsa-let-7e-5p	PAR-CLIP	21572407
MIRT548350	hsa-let-7a-5p	PAR-CLIP	21572407
MIRT548349	hsa-let-7g-5p	PAR-CLIP	21572407
MIRT548347	hsa-miR-4458	PAR-CLIP	21572407
MIRT548348	hsa-let-7f-5p	PAR-CLIP	21572407
MIRT548346	hsa-let-7d-5p	PAR-CLIP	21572407
MIRT548345	hsa-let-7i-5p	PAR-CLIP	21572407
MIRT548344	hsa-let-7c-5p	PAR-CLIP	21572407
MIRT548342	hsa-miR-4500	PAR-CLIP	21572407
MIRT548343	hsa-let-7b-5p	PAR-CLIP	21572407
MIRT548340	hsa-miR-7844-5p	PAR-CLIP	21572407
MIRT548341	hsa-miR-3609	PAR-CLIP	21572407
MIRT548339	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT548338	hsa-miR-4796-3p	PAR-CLIP	21572407
MIRT548337	hsa-miR-3129-3p	PAR-CLIP	21572407
MIRT548336	hsa-miR-5583-5p	PAR-CLIP	21572407
MIRT548334	hsa-miR-4275	PAR-CLIP	21572407
MIRT548335	hsa-miR-490-5p	PAR-CLIP	21572407
MIRT548333	hsa-miR-4735-5p	PAR-CLIP	21572407
MIRT548332	hsa-miR-676-5p	PAR-CLIP	21572407
MIRT548331	hsa-miR-202-3p	PAR-CLIP	21572407
MIRT548330	hsa-miR-6744-5p	PAR-CLIP	21572407
MIRT548329	hsa-miR-1255a	PAR-CLIP	21572407
MIRT548328	hsa-miR-1255b-5p	PAR-CLIP	21572407
MIRT548309	hsa-miR-22-5p	PAR-CLIP	21572407
MIRT548327	hsa-miR-5011-3p	PAR-CLIP	21572407
MIRT548326	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT548325	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT548324	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT548323	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT548322	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT027959	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT548321	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT548320	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT548319	hsa-miR-548az-5p	PAR-CLIP	21572407
MIRT548318	hsa-miR-548t-5p	PAR-CLIP	21572407
MIRT548317	hsa-miR-519a-3p	PAR-CLIP	21572407
MIRT548316	hsa-miR-519b-3p	PAR-CLIP	21572407
MIRT548315	hsa-miR-519c-3p	PAR-CLIP	21572407
MIRT548314	hsa-miR-5584-3p	PAR-CLIP	21572407
MIRT548313	hsa-miR-4277	PAR-CLIP	21572407
MIRT548312	hsa-miR-548ao-5p	PAR-CLIP	21572407
MIRT548311	hsa-miR-548ax	PAR-CLIP	21572407
MIRT548310	hsa-miR-143-5p	PAR-CLIP	21572407
MIRT548309	hsa-miR-22-5p	PAR-CLIP	21572407
MIRT735262	hsa-miR-21-3p	Luciferase reporter assay, Immunofluorescence, qRT-PCR	32507001
MIRT711424	hsa-miR-1911-3p	HITS-CLIP	19536157
MIRT711423	hsa-miR-4733-3p	HITS-CLIP	19536157
MIRT711422	hsa-miR-3937	HITS-CLIP	19536157
MIRT711421	hsa-miR-597-5p	HITS-CLIP	19536157
MIRT711420	hsa-miR-592	HITS-CLIP	19536157
MIRT711424	hsa-miR-1911-3p	HITS-CLIP	19536157
MIRT711423	hsa-miR-4733-3p	HITS-CLIP	19536157
MIRT711422	hsa-miR-3937	HITS-CLIP	19536157
MIRT711421	hsa-miR-597-5p	HITS-CLIP	19536157
MIRT711420	hsa-miR-592	HITS-CLIP	19536157
MIRT711424	hsa-miR-1911-3p	HITS-CLIP	19536157
MIRT711423	hsa-miR-4733-3p	HITS-CLIP	19536157
MIRT711422	hsa-miR-3937	HITS-CLIP	19536157
MIRT711421	hsa-miR-597-5p	HITS-CLIP	19536157
MIRT711420	hsa-miR-592	HITS-CLIP	19536157
MIRT638763	hsa-miR-605-5p	HITS-CLIP	23824327
MIRT638762	hsa-miR-4645-5p	HITS-CLIP	23824327
MIRT638761	hsa-miR-4673	HITS-CLIP	23824327
MIRT638760	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT638759	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT638758	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT638757	hsa-miR-623	HITS-CLIP	23824327
MIRT638756	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT638755	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT638754	hsa-miR-3180-5p	HITS-CLIP	23824327
MIRT638753	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT638752	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT638751	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT548352	hsa-miR-98-5p	PAR-CLIP	21572407
MIRT548351	hsa-let-7e-5p	PAR-CLIP	21572407
MIRT548350	hsa-let-7a-5p	PAR-CLIP	21572407
MIRT548349	hsa-let-7g-5p	PAR-CLIP	21572407
MIRT548347	hsa-miR-4458	PAR-CLIP	21572407
MIRT548348	hsa-let-7f-5p	PAR-CLIP	21572407
MIRT548346	hsa-let-7d-5p	PAR-CLIP	21572407
MIRT548345	hsa-let-7i-5p	PAR-CLIP	21572407
MIRT548344	hsa-let-7c-5p	PAR-CLIP	21572407
MIRT548342	hsa-miR-4500	PAR-CLIP	21572407
MIRT548343	hsa-let-7b-5p	PAR-CLIP	21572407
MIRT548340	hsa-miR-7844-5p	PAR-CLIP	21572407
MIRT548341	hsa-miR-3609	PAR-CLIP	21572407
MIRT548339	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT548338	hsa-miR-4796-3p	PAR-CLIP	21572407
MIRT548337	hsa-miR-3129-3p	PAR-CLIP	21572407
MIRT548336	hsa-miR-5583-5p	PAR-CLIP	21572407
MIRT016908	hsa-miR-335-5p	PAR-CLIP	21572407
MIRT548334	hsa-miR-4275	PAR-CLIP	21572407
MIRT548335	hsa-miR-490-5p	PAR-CLIP	21572407
MIRT548332	hsa-miR-676-5p	PAR-CLIP	21572407
MIRT548331	hsa-miR-202-3p	PAR-CLIP	21572407
MIRT548330	hsa-miR-6744-5p	PAR-CLIP	21572407
MIRT548329	hsa-miR-1255a	PAR-CLIP	21572407
MIRT548328	hsa-miR-1255b-5p	PAR-CLIP	21572407
MIRT548309	hsa-miR-22-5p	PAR-CLIP	21572407
MIRT548327	hsa-miR-5011-3p	PAR-CLIP	21572407
MIRT558081	hsa-miR-498	PAR-CLIP	21572407
MIRT548352	hsa-miR-98-5p	PAR-CLIP	21572407
MIRT548351	hsa-let-7e-5p	PAR-CLIP	21572407
MIRT548350	hsa-let-7a-5p	PAR-CLIP	21572407
MIRT548349	hsa-let-7g-5p	PAR-CLIP	21572407
MIRT548347	hsa-miR-4458	PAR-CLIP	21572407
MIRT548348	hsa-let-7f-5p	PAR-CLIP	21572407
MIRT548346	hsa-let-7d-5p	PAR-CLIP	21572407
MIRT548345	hsa-let-7i-5p	PAR-CLIP	21572407
MIRT548344	hsa-let-7c-5p	PAR-CLIP	21572407
MIRT548342	hsa-miR-4500	PAR-CLIP	21572407
MIRT548343	hsa-let-7b-5p	PAR-CLIP	21572407
MIRT548340	hsa-miR-7844-5p	PAR-CLIP	21572407
MIRT548341	hsa-miR-3609	PAR-CLIP	21572407
MIRT548339	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT548338	hsa-miR-4796-3p	PAR-CLIP	21572407
MIRT548337	hsa-miR-3129-3p	PAR-CLIP	21572407
MIRT548336	hsa-miR-5583-5p	PAR-CLIP	21572407
MIRT548334	hsa-miR-4275	PAR-CLIP	21572407
MIRT548335	hsa-miR-490-5p	PAR-CLIP	21572407
MIRT548333	hsa-miR-4735-5p	PAR-CLIP	21572407
MIRT548332	hsa-miR-676-5p	PAR-CLIP	21572407
MIRT548331	hsa-miR-202-3p	PAR-CLIP	21572407
MIRT548330	hsa-miR-6744-5p	PAR-CLIP	21572407
MIRT548329	hsa-miR-1255a	PAR-CLIP	21572407
MIRT548328	hsa-miR-1255b-5p	PAR-CLIP	21572407
MIRT548309	hsa-miR-22-5p	PAR-CLIP	21572407
MIRT548327	hsa-miR-5011-3p	PAR-CLIP	21572407
MIRT548326	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT548325	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT548324	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT548323	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT548322	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT027959	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT548321	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT548320	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT548319	hsa-miR-548az-5p	PAR-CLIP	21572407
MIRT548318	hsa-miR-548t-5p	PAR-CLIP	21572407
MIRT548317	hsa-miR-519a-3p	PAR-CLIP	21572407
MIRT548316	hsa-miR-519b-3p	PAR-CLIP	21572407
MIRT548315	hsa-miR-519c-3p	PAR-CLIP	21572407
MIRT548314	hsa-miR-5584-3p	PAR-CLIP	21572407
MIRT548313	hsa-miR-4277	PAR-CLIP	21572407
MIRT548312	hsa-miR-548ao-5p	PAR-CLIP	21572407
MIRT548311	hsa-miR-548ax	PAR-CLIP	21572407
MIRT548310	hsa-miR-143-5p	PAR-CLIP	21572407
MIRT548309	hsa-miR-22-5p	PAR-CLIP	21572407
MIRT966408	hsa-let-7a	CLIP-seq
MIRT966409	hsa-let-7b	CLIP-seq
MIRT966410	hsa-let-7c	CLIP-seq
MIRT966411	hsa-let-7d	CLIP-seq
MIRT966412	hsa-let-7e	CLIP-seq
MIRT966413	hsa-let-7f	CLIP-seq
MIRT966414	hsa-let-7g	CLIP-seq
MIRT966415	hsa-let-7i	CLIP-seq
MIRT966416	hsa-miR-103a	CLIP-seq
MIRT966417	hsa-miR-105	CLIP-seq
MIRT966418	hsa-miR-106a	CLIP-seq
MIRT966419	hsa-miR-106b	CLIP-seq
MIRT966420	hsa-miR-107	CLIP-seq
MIRT966421	hsa-miR-10a	CLIP-seq
MIRT966422	hsa-miR-10b	CLIP-seq
MIRT966423	hsa-miR-1203	CLIP-seq
MIRT966424	hsa-miR-1228	CLIP-seq
MIRT966425	hsa-miR-1231	CLIP-seq
MIRT966426	hsa-miR-1255b	CLIP-seq
MIRT966427	hsa-miR-125a-5p	CLIP-seq
MIRT966428	hsa-miR-125b	CLIP-seq
MIRT966429	hsa-miR-1278	CLIP-seq
MIRT966430	hsa-miR-1299	CLIP-seq
MIRT966431	hsa-miR-1323	CLIP-seq
MIRT966432	hsa-miR-133a	CLIP-seq
MIRT966433	hsa-miR-133b	CLIP-seq
MIRT966434	hsa-miR-153	CLIP-seq
MIRT966435	hsa-miR-17	CLIP-seq
MIRT966436	hsa-miR-1827	CLIP-seq
MIRT966437	hsa-miR-183	CLIP-seq
MIRT966438	hsa-miR-185	CLIP-seq
MIRT966439	hsa-miR-200b	CLIP-seq
MIRT966440	hsa-miR-200c	CLIP-seq
MIRT966441	hsa-miR-202	CLIP-seq
MIRT966442	hsa-miR-205	CLIP-seq
MIRT966443	hsa-miR-2052	CLIP-seq
MIRT966444	hsa-miR-2054	CLIP-seq
MIRT966445	hsa-miR-20a	CLIP-seq
MIRT966446	hsa-miR-20b	CLIP-seq
MIRT966447	hsa-miR-219-2-3p	CLIP-seq
MIRT966448	hsa-miR-2682	CLIP-seq
MIRT966449	hsa-miR-27a	CLIP-seq
MIRT966450	hsa-miR-27b	CLIP-seq
MIRT966451	hsa-miR-2964a-3p	CLIP-seq
MIRT966452	hsa-miR-3064-3p	CLIP-seq
MIRT966453	hsa-miR-3065-5p	CLIP-seq
MIRT966454	hsa-miR-3115	CLIP-seq
MIRT966455	hsa-miR-3120-3p	CLIP-seq
MIRT966456	hsa-miR-3123	CLIP-seq
MIRT966457	hsa-miR-3128	CLIP-seq
MIRT966458	hsa-miR-3148	CLIP-seq
MIRT966459	hsa-miR-3160-5p	CLIP-seq
MIRT966460	hsa-miR-323b-5p	CLIP-seq
MIRT966461	hsa-miR-329	CLIP-seq
MIRT966462	hsa-miR-335	CLIP-seq
MIRT966463	hsa-miR-339-5p	CLIP-seq
MIRT966464	hsa-miR-342-3p	CLIP-seq
MIRT966465	hsa-miR-34a	CLIP-seq
MIRT966466	hsa-miR-34c-5p	CLIP-seq
MIRT966467	hsa-miR-3607-3p	CLIP-seq
MIRT966468	hsa-miR-3614-5p	CLIP-seq
MIRT966469	hsa-miR-3620	CLIP-seq
MIRT966470	hsa-miR-362-3p	CLIP-seq
MIRT966471	hsa-miR-362-5p	CLIP-seq
MIRT966472	hsa-miR-3662	CLIP-seq
MIRT966473	hsa-miR-3663-3p	CLIP-seq
MIRT966474	hsa-miR-3675-5p	CLIP-seq
MIRT966475	hsa-miR-3682-5p	CLIP-seq
MIRT966476	hsa-miR-3686	CLIP-seq
MIRT966477	hsa-miR-374c	CLIP-seq
MIRT966478	hsa-miR-377	CLIP-seq
MIRT966479	hsa-miR-380	CLIP-seq
MIRT966480	hsa-miR-3940-5p	CLIP-seq
MIRT966481	hsa-miR-3941	CLIP-seq
MIRT966482	hsa-miR-3942-3p	CLIP-seq
MIRT966483	hsa-miR-412	CLIP-seq
MIRT966484	hsa-miR-421	CLIP-seq
MIRT966485	hsa-miR-4255	CLIP-seq
MIRT966486	hsa-miR-4257	CLIP-seq
MIRT966487	hsa-miR-4270	CLIP-seq
MIRT966488	hsa-miR-4272	CLIP-seq
MIRT966489	hsa-miR-4283	CLIP-seq
MIRT966490	hsa-miR-429	CLIP-seq
MIRT966491	hsa-miR-4291	CLIP-seq
MIRT966492	hsa-miR-4292	CLIP-seq
MIRT966493	hsa-miR-4302	CLIP-seq
MIRT966494	hsa-miR-4306	CLIP-seq
MIRT966495	hsa-miR-4315	CLIP-seq
MIRT966496	hsa-miR-4319	CLIP-seq
MIRT966497	hsa-miR-4323	CLIP-seq
MIRT966498	hsa-miR-4330	CLIP-seq
MIRT966499	hsa-miR-4441	CLIP-seq
MIRT966500	hsa-miR-448	CLIP-seq
MIRT966501	hsa-miR-4489	CLIP-seq
MIRT966502	hsa-miR-449a	CLIP-seq
MIRT966503	hsa-miR-449b	CLIP-seq
MIRT966504	hsa-miR-449c	CLIP-seq
MIRT966505	hsa-miR-4507	CLIP-seq
MIRT966506	hsa-miR-4643	CLIP-seq
MIRT966507	hsa-miR-4644	CLIP-seq
MIRT966508	hsa-miR-4652-3p	CLIP-seq
MIRT966509	hsa-miR-466	CLIP-seq
MIRT966510	hsa-miR-4694-3p	CLIP-seq
MIRT966511	hsa-miR-4709-3p	CLIP-seq
MIRT966512	hsa-miR-4714-3p	CLIP-seq
MIRT966513	hsa-miR-4715-5p	CLIP-seq
MIRT966514	hsa-miR-4720-5p	CLIP-seq
MIRT966515	hsa-miR-4724-5p	CLIP-seq
MIRT966516	hsa-miR-4732-3p	CLIP-seq
MIRT966517	hsa-miR-4757-5p	CLIP-seq
MIRT966518	hsa-miR-4758-3p	CLIP-seq
MIRT966519	hsa-miR-4775	CLIP-seq
MIRT966520	hsa-miR-4777-3p	CLIP-seq
MIRT966521	hsa-miR-4789-3p	CLIP-seq
MIRT966522	hsa-miR-4789-5p	CLIP-seq
MIRT966523	hsa-miR-4790-5p	CLIP-seq
MIRT966524	hsa-miR-4799-3p	CLIP-seq
MIRT966525	hsa-miR-500b	CLIP-seq
MIRT966526	hsa-miR-501-5p	CLIP-seq
MIRT966527	hsa-miR-513a-5p	CLIP-seq
MIRT966528	hsa-miR-515-5p	CLIP-seq
MIRT966529	hsa-miR-519a	CLIP-seq
MIRT966530	hsa-miR-519d	CLIP-seq
MIRT966531	hsa-miR-545	CLIP-seq
MIRT966532	hsa-miR-548ah	CLIP-seq
MIRT966533	hsa-miR-548l	CLIP-seq
MIRT966534	hsa-miR-548n	CLIP-seq
MIRT966535	hsa-miR-548o	CLIP-seq
MIRT966536	hsa-miR-548t	CLIP-seq
MIRT966537	hsa-miR-555	CLIP-seq
MIRT966538	hsa-miR-579	CLIP-seq
MIRT966539	hsa-miR-603	CLIP-seq
MIRT966540	hsa-miR-655	CLIP-seq
MIRT966541	hsa-miR-670	CLIP-seq
MIRT966542	hsa-miR-767-5p	CLIP-seq
MIRT966543	hsa-miR-875-3p	CLIP-seq
MIRT966544	hsa-miR-885-3p	CLIP-seq
MIRT966545	hsa-miR-93	CLIP-seq
MIRT966546	hsa-miR-98	CLIP-seq
MIRT966408	hsa-let-7a	CLIP-seq
MIRT966409	hsa-let-7b	CLIP-seq
MIRT966410	hsa-let-7c	CLIP-seq
MIRT966411	hsa-let-7d	CLIP-seq
MIRT966412	hsa-let-7e	CLIP-seq
MIRT966413	hsa-let-7f	CLIP-seq
MIRT966414	hsa-let-7g	CLIP-seq
MIRT966415	hsa-let-7i	CLIP-seq
MIRT966417	hsa-miR-105	CLIP-seq
MIRT966418	hsa-miR-106a	CLIP-seq
MIRT966419	hsa-miR-106b	CLIP-seq
MIRT1986238	hsa-miR-1179	CLIP-seq
MIRT1986239	hsa-miR-1184	CLIP-seq
MIRT1986240	hsa-miR-1205	CLIP-seq
MIRT966426	hsa-miR-1255b	CLIP-seq
MIRT1986241	hsa-miR-1273g	CLIP-seq
MIRT1986242	hsa-miR-1324	CLIP-seq
MIRT1986243	hsa-miR-136	CLIP-seq
MIRT1986244	hsa-miR-138	CLIP-seq
MIRT1986245	hsa-miR-147	CLIP-seq
MIRT966434	hsa-miR-153	CLIP-seq
MIRT966435	hsa-miR-17	CLIP-seq
MIRT966441	hsa-miR-202	CLIP-seq
MIRT966443	hsa-miR-2052	CLIP-seq
MIRT966444	hsa-miR-2054	CLIP-seq
MIRT966445	hsa-miR-20a	CLIP-seq
MIRT966446	hsa-miR-20b	CLIP-seq
MIRT1986246	hsa-miR-2113	CLIP-seq
MIRT966447	hsa-miR-219-2-3p	CLIP-seq
MIRT1986247	hsa-miR-2467-3p	CLIP-seq
MIRT966448	hsa-miR-2682	CLIP-seq
MIRT966451	hsa-miR-2964a-3p	CLIP-seq
MIRT966453	hsa-miR-3065-5p	CLIP-seq
MIRT966454	hsa-miR-3115	CLIP-seq
MIRT1986248	hsa-miR-3119	CLIP-seq
MIRT1986249	hsa-miR-3137	CLIP-seq
MIRT1986250	hsa-miR-3158-5p	CLIP-seq
MIRT1986251	hsa-miR-3168	CLIP-seq
MIRT1986252	hsa-miR-3194-3p	CLIP-seq
MIRT1986253	hsa-miR-33a	CLIP-seq
MIRT1986254	hsa-miR-33b	CLIP-seq
MIRT966467	hsa-miR-3607-3p	CLIP-seq
MIRT1986255	hsa-miR-3622a-3p	CLIP-seq
MIRT1986256	hsa-miR-3622b-3p	CLIP-seq
MIRT1986257	hsa-miR-3661	CLIP-seq
MIRT1986258	hsa-miR-3667-5p	CLIP-seq
MIRT1986259	hsa-miR-3671	CLIP-seq
MIRT1986260	hsa-miR-3678-3p	CLIP-seq
MIRT1986261	hsa-miR-3682-3p	CLIP-seq
MIRT966475	hsa-miR-3682-5p	CLIP-seq
MIRT966476	hsa-miR-3686	CLIP-seq
MIRT1986262	hsa-miR-3907	CLIP-seq
MIRT1986263	hsa-miR-3911	CLIP-seq
MIRT966482	hsa-miR-3942-3p	CLIP-seq
MIRT966484	hsa-miR-421	CLIP-seq
MIRT1986264	hsa-miR-4251	CLIP-seq
MIRT966488	hsa-miR-4272	CLIP-seq
MIRT966491	hsa-miR-4291	CLIP-seq
MIRT1986265	hsa-miR-4303	CLIP-seq
MIRT966497	hsa-miR-4323	CLIP-seq
MIRT1986266	hsa-miR-4329	CLIP-seq
MIRT966500	hsa-miR-448	CLIP-seq
MIRT1986267	hsa-miR-4487	CLIP-seq
MIRT966504	hsa-miR-449c	CLIP-seq
MIRT966508	hsa-miR-4652-3p	CLIP-seq
MIRT1986268	hsa-miR-4660	CLIP-seq
MIRT1986269	hsa-miR-4703-3p	CLIP-seq
MIRT966511	hsa-miR-4709-3p	CLIP-seq
MIRT966514	hsa-miR-4720-5p	CLIP-seq
MIRT1986270	hsa-miR-4729	CLIP-seq
MIRT966518	hsa-miR-4758-3p	CLIP-seq
MIRT966519	hsa-miR-4775	CLIP-seq
MIRT966521	hsa-miR-4789-3p	CLIP-seq
MIRT966524	hsa-miR-4799-3p	CLIP-seq
MIRT966528	hsa-miR-515-5p	CLIP-seq
MIRT966529	hsa-miR-519a	CLIP-seq
MIRT966530	hsa-miR-519d	CLIP-seq
MIRT1986271	hsa-miR-539	CLIP-seq
MIRT966531	hsa-miR-545	CLIP-seq
MIRT966532	hsa-miR-548ah	CLIP-seq
MIRT1986272	hsa-miR-548k	CLIP-seq
MIRT966533	hsa-miR-548l	CLIP-seq
MIRT966534	hsa-miR-548n	CLIP-seq
MIRT1986273	hsa-miR-548q	CLIP-seq
MIRT1986274	hsa-miR-590-3p	CLIP-seq
MIRT1986275	hsa-miR-599	CLIP-seq
MIRT1986276	hsa-miR-607	CLIP-seq
MIRT1986277	hsa-miR-631	CLIP-seq
MIRT1986278	hsa-miR-642b	CLIP-seq
MIRT1986279	hsa-miR-644	CLIP-seq
MIRT1986280	hsa-miR-760	CLIP-seq
MIRT966542	hsa-miR-767-5p	CLIP-seq
MIRT1986281	hsa-miR-892b	CLIP-seq
MIRT966545	hsa-miR-93	CLIP-seq
MIRT1986282	hsa-miR-940	CLIP-seq
MIRT966546	hsa-miR-98	CLIP-seq
MIRT966408	hsa-let-7a	CLIP-seq
MIRT966409	hsa-let-7b	CLIP-seq
MIRT966410	hsa-let-7c	CLIP-seq
MIRT966411	hsa-let-7d	CLIP-seq
MIRT966412	hsa-let-7e	CLIP-seq
MIRT966413	hsa-let-7f	CLIP-seq
MIRT966414	hsa-let-7g	CLIP-seq
MIRT966415	hsa-let-7i	CLIP-seq
MIRT966416	hsa-miR-103a	CLIP-seq
MIRT966417	hsa-miR-105	CLIP-seq
MIRT966418	hsa-miR-106a	CLIP-seq
MIRT966419	hsa-miR-106b	CLIP-seq
MIRT966420	hsa-miR-107	CLIP-seq
MIRT1986238	hsa-miR-1179	CLIP-seq
MIRT1986239	hsa-miR-1184	CLIP-seq
MIRT966423	hsa-miR-1203	CLIP-seq
MIRT1986240	hsa-miR-1205	CLIP-seq
MIRT966424	hsa-miR-1228	CLIP-seq
MIRT966425	hsa-miR-1231	CLIP-seq
MIRT966426	hsa-miR-1255b	CLIP-seq
MIRT966432	hsa-miR-133a	CLIP-seq
MIRT966433	hsa-miR-133b	CLIP-seq
MIRT1986244	hsa-miR-138	CLIP-seq
MIRT2220853	hsa-miR-145	CLIP-seq
MIRT966434	hsa-miR-153	CLIP-seq
MIRT966435	hsa-miR-17	CLIP-seq
MIRT2220854	hsa-miR-198	CLIP-seq
MIRT966441	hsa-miR-202	CLIP-seq
MIRT966443	hsa-miR-2052	CLIP-seq
MIRT966445	hsa-miR-20a	CLIP-seq
MIRT966446	hsa-miR-20b	CLIP-seq
MIRT1986246	hsa-miR-2113	CLIP-seq
MIRT966447	hsa-miR-219-2-3p	CLIP-seq
MIRT2220855	hsa-miR-2355-3p	CLIP-seq
MIRT1986247	hsa-miR-2467-3p	CLIP-seq
MIRT966451	hsa-miR-2964a-3p	CLIP-seq
MIRT966452	hsa-miR-3064-3p	CLIP-seq
MIRT966454	hsa-miR-3115	CLIP-seq
MIRT1986248	hsa-miR-3119	CLIP-seq
MIRT966457	hsa-miR-3128	CLIP-seq
MIRT1986249	hsa-miR-3137	CLIP-seq
MIRT1986250	hsa-miR-3158-5p	CLIP-seq
MIRT1986252	hsa-miR-3194-3p	CLIP-seq
MIRT966461	hsa-miR-329	CLIP-seq
MIRT966467	hsa-miR-3607-3p	CLIP-seq
MIRT966468	hsa-miR-3614-5p	CLIP-seq
MIRT966469	hsa-miR-3620	CLIP-seq
MIRT1986255	hsa-miR-3622a-3p	CLIP-seq
MIRT1986256	hsa-miR-3622b-3p	CLIP-seq
MIRT966470	hsa-miR-362-3p	CLIP-seq
MIRT966472	hsa-miR-3662	CLIP-seq
MIRT966473	hsa-miR-3663-3p	CLIP-seq
MIRT1986259	hsa-miR-3671	CLIP-seq
MIRT966474	hsa-miR-3675-5p	CLIP-seq
MIRT1986260	hsa-miR-3678-3p	CLIP-seq
MIRT966475	hsa-miR-3682-5p	CLIP-seq
MIRT966476	hsa-miR-3686	CLIP-seq
MIRT2220856	hsa-miR-375	CLIP-seq
MIRT966478	hsa-miR-377	CLIP-seq
MIRT1986262	hsa-miR-3907	CLIP-seq
MIRT2220857	hsa-miR-3925-3p	CLIP-seq
MIRT966480	hsa-miR-3940-5p	CLIP-seq
MIRT966482	hsa-miR-3942-3p	CLIP-seq
MIRT1986264	hsa-miR-4251	CLIP-seq
MIRT966486	hsa-miR-4257	CLIP-seq
MIRT2220858	hsa-miR-4278	CLIP-seq
MIRT966489	hsa-miR-4283	CLIP-seq
MIRT966491	hsa-miR-4291	CLIP-seq
MIRT966492	hsa-miR-4292	CLIP-seq
MIRT966493	hsa-miR-4302	CLIP-seq
MIRT1986265	hsa-miR-4303	CLIP-seq
MIRT966497	hsa-miR-4323	CLIP-seq
MIRT1986266	hsa-miR-4329	CLIP-seq
MIRT966498	hsa-miR-4330	CLIP-seq
MIRT966500	hsa-miR-448	CLIP-seq
MIRT1986267	hsa-miR-4487	CLIP-seq
MIRT966501	hsa-miR-4489	CLIP-seq
MIRT966505	hsa-miR-4507	CLIP-seq
MIRT2220859	hsa-miR-4639-3p	CLIP-seq
MIRT2220860	hsa-miR-4646-3p	CLIP-seq
MIRT966508	hsa-miR-4652-3p	CLIP-seq
MIRT1986268	hsa-miR-4660	CLIP-seq
MIRT2220861	hsa-miR-4680-5p	CLIP-seq
MIRT966514	hsa-miR-4720-5p	CLIP-seq
MIRT966518	hsa-miR-4758-3p	CLIP-seq
MIRT2220862	hsa-miR-4773	CLIP-seq
MIRT966519	hsa-miR-4775	CLIP-seq
MIRT966524	hsa-miR-4799-3p	CLIP-seq
MIRT966528	hsa-miR-515-5p	CLIP-seq
MIRT966529	hsa-miR-519a	CLIP-seq
MIRT966530	hsa-miR-519d	CLIP-seq
MIRT1986271	hsa-miR-539	CLIP-seq
MIRT966531	hsa-miR-545	CLIP-seq
MIRT966532	hsa-miR-548ah	CLIP-seq
MIRT1986272	hsa-miR-548k	CLIP-seq
MIRT966533	hsa-miR-548l	CLIP-seq
MIRT966534	hsa-miR-548n	CLIP-seq
MIRT1986273	hsa-miR-548q	CLIP-seq
MIRT966536	hsa-miR-548t	CLIP-seq
MIRT966537	hsa-miR-555	CLIP-seq
MIRT966538	hsa-miR-579	CLIP-seq
MIRT966539	hsa-miR-603	CLIP-seq
MIRT1986276	hsa-miR-607	CLIP-seq
MIRT2220863	hsa-miR-668	CLIP-seq
MIRT1986280	hsa-miR-760	CLIP-seq
MIRT2220864	hsa-miR-766	CLIP-seq
MIRT966542	hsa-miR-767-5p	CLIP-seq
MIRT966544	hsa-miR-885-3p	CLIP-seq
MIRT1986281	hsa-miR-892b	CLIP-seq
MIRT966545	hsa-miR-93	CLIP-seq
MIRT966546	hsa-miR-98	CLIP-seq
MIRT966465	hsa-miR-34a	CLIP-seq
MIRT966466	hsa-miR-34c-5p	CLIP-seq
MIRT966502	hsa-miR-449a	CLIP-seq
MIRT966503	hsa-miR-449b	CLIP-seq
MIRT2387486	hsa-miR-4711-3p	CLIP-seq
MIRT2428607	hsa-miR-4434	CLIP-seq
MIRT2428608	hsa-miR-4516	CLIP-seq
MIRT2428609	hsa-miR-4531	CLIP-seq
MIRT2428610	hsa-miR-4728-3p	CLIP-seq
MIRT2220862	hsa-miR-4773	CLIP-seq
MIRT2428607	hsa-miR-4434	CLIP-seq
MIRT2428608	hsa-miR-4516	CLIP-seq
MIRT2428609	hsa-miR-4531	CLIP-seq
MIRT2428610	hsa-miR-4728-3p	CLIP-seq
MIRT2220862	hsa-miR-4773	CLIP-seq
MIRT2428607	hsa-miR-4434	CLIP-seq
MIRT2428608	hsa-miR-4516	CLIP-seq
MIRT2428609	hsa-miR-4531	CLIP-seq
MIRT2428610	hsa-miR-4728-3p	CLIP-seq
MIRT2220862	hsa-miR-4773	CLIP-seq
MIRT1986239	hsa-miR-1184	CLIP-seq
MIRT2524548	hsa-miR-1197	CLIP-seq
MIRT1986240	hsa-miR-1205	CLIP-seq
MIRT966424	hsa-miR-1228	CLIP-seq
MIRT2524549	hsa-miR-1258	CLIP-seq
MIRT2524550	hsa-miR-1270	CLIP-seq
MIRT2524551	hsa-miR-1273e	CLIP-seq
MIRT2524552	hsa-miR-1279	CLIP-seq
MIRT2524553	hsa-miR-1286	CLIP-seq
MIRT966431	hsa-miR-1323	CLIP-seq
MIRT1986244	hsa-miR-138	CLIP-seq
MIRT2220853	hsa-miR-145	CLIP-seq
MIRT966434	hsa-miR-153	CLIP-seq
MIRT966436	hsa-miR-1827	CLIP-seq
MIRT966437	hsa-miR-183	CLIP-seq
MIRT2524554	hsa-miR-1972	CLIP-seq
MIRT2220854	hsa-miR-198	CLIP-seq
MIRT966447	hsa-miR-219-2-3p	CLIP-seq
MIRT2220855	hsa-miR-2355-3p	CLIP-seq
MIRT1986247	hsa-miR-2467-3p	CLIP-seq
MIRT966448	hsa-miR-2682	CLIP-seq
MIRT966451	hsa-miR-2964a-3p	CLIP-seq
MIRT966453	hsa-miR-3065-5p	CLIP-seq
MIRT966454	hsa-miR-3115	CLIP-seq
MIRT2524555	hsa-miR-3117-3p	CLIP-seq
MIRT966455	hsa-miR-3120-3p	CLIP-seq
MIRT2524556	hsa-miR-3136-3p	CLIP-seq
MIRT1986250	hsa-miR-3158-5p	CLIP-seq
MIRT1986252	hsa-miR-3194-3p	CLIP-seq
MIRT966461	hsa-miR-329	CLIP-seq
MIRT966465	hsa-miR-34a	CLIP-seq
MIRT966466	hsa-miR-34c-5p	CLIP-seq
MIRT2524557	hsa-miR-3613-3p	CLIP-seq
MIRT966470	hsa-miR-362-3p	CLIP-seq
MIRT966474	hsa-miR-3675-5p	CLIP-seq
MIRT1986260	hsa-miR-3678-3p	CLIP-seq
MIRT2524558	hsa-miR-3688-3p	CLIP-seq
MIRT1986262	hsa-miR-3907	CLIP-seq
MIRT966480	hsa-miR-3940-5p	CLIP-seq
MIRT966481	hsa-miR-3941	CLIP-seq
MIRT966484	hsa-miR-421	CLIP-seq
MIRT966485	hsa-miR-4255	CLIP-seq
MIRT966486	hsa-miR-4257	CLIP-seq
MIRT966488	hsa-miR-4272	CLIP-seq
MIRT2524559	hsa-miR-4276	CLIP-seq
MIRT2220858	hsa-miR-4278	CLIP-seq
MIRT966489	hsa-miR-4283	CLIP-seq
MIRT2524560	hsa-miR-4301	CLIP-seq
MIRT966493	hsa-miR-4302	CLIP-seq
MIRT2524561	hsa-miR-4311	CLIP-seq
MIRT2524562	hsa-miR-4432	CLIP-seq
MIRT2428607	hsa-miR-4434	CLIP-seq
MIRT2524563	hsa-miR-4474-5p	CLIP-seq
MIRT966500	hsa-miR-448	CLIP-seq
MIRT1986267	hsa-miR-4487	CLIP-seq
MIRT966501	hsa-miR-4489	CLIP-seq
MIRT966502	hsa-miR-449a	CLIP-seq
MIRT966503	hsa-miR-449b	CLIP-seq
MIRT966504	hsa-miR-449c	CLIP-seq
MIRT966505	hsa-miR-4507	CLIP-seq
MIRT2428608	hsa-miR-4516	CLIP-seq
MIRT2428609	hsa-miR-4531	CLIP-seq
MIRT2220860	hsa-miR-4646-3p	CLIP-seq
MIRT2524564	hsa-miR-4650-5p	CLIP-seq
MIRT2524565	hsa-miR-4662a-3p	CLIP-seq
MIRT2524566	hsa-miR-4666-5p	CLIP-seq
MIRT2524567	hsa-miR-4667-5p	CLIP-seq
MIRT2524568	hsa-miR-4690-3p	CLIP-seq
MIRT2524569	hsa-miR-4700-5p	CLIP-seq
MIRT2524570	hsa-miR-4722-5p	CLIP-seq
MIRT2428610	hsa-miR-4728-3p	CLIP-seq
MIRT1986270	hsa-miR-4729	CLIP-seq
MIRT2220862	hsa-miR-4773	CLIP-seq
MIRT966521	hsa-miR-4789-3p	CLIP-seq
MIRT2524571	hsa-miR-486-3p	CLIP-seq
MIRT2524572	hsa-miR-491-3p	CLIP-seq
MIRT2524573	hsa-miR-499-5p	CLIP-seq
MIRT966528	hsa-miR-515-5p	CLIP-seq
MIRT2524574	hsa-miR-521	CLIP-seq
MIRT966531	hsa-miR-545	CLIP-seq
MIRT2524575	hsa-miR-548aa	CLIP-seq
MIRT966533	hsa-miR-548l	CLIP-seq
MIRT966534	hsa-miR-548n	CLIP-seq
MIRT966535	hsa-miR-548o	CLIP-seq
MIRT1986273	hsa-miR-548q	CLIP-seq
MIRT2524576	hsa-miR-570	CLIP-seq
MIRT966538	hsa-miR-579	CLIP-seq
MIRT966539	hsa-miR-603	CLIP-seq
MIRT2524577	hsa-miR-620	CLIP-seq
MIRT2524578	hsa-miR-637	CLIP-seq
MIRT1986278	hsa-miR-642b	CLIP-seq
MIRT1986280	hsa-miR-760	CLIP-seq
MIRT966544	hsa-miR-885-3p	CLIP-seq
MIRT1986239	hsa-miR-1184	CLIP-seq
MIRT2524548	hsa-miR-1197	CLIP-seq
MIRT1986240	hsa-miR-1205	CLIP-seq
MIRT966424	hsa-miR-1228	CLIP-seq
MIRT2524549	hsa-miR-1258	CLIP-seq
MIRT2524551	hsa-miR-1273e	CLIP-seq
MIRT2524552	hsa-miR-1279	CLIP-seq
MIRT2524553	hsa-miR-1286	CLIP-seq
MIRT966431	hsa-miR-1323	CLIP-seq
MIRT1986244	hsa-miR-138	CLIP-seq
MIRT966434	hsa-miR-153	CLIP-seq
MIRT966436	hsa-miR-1827	CLIP-seq
MIRT966447	hsa-miR-219-2-3p	CLIP-seq
MIRT1986247	hsa-miR-2467-3p	CLIP-seq
MIRT966448	hsa-miR-2682	CLIP-seq
MIRT966451	hsa-miR-2964a-3p	CLIP-seq
MIRT966453	hsa-miR-3065-5p	CLIP-seq
MIRT2680176	hsa-miR-3074-3p	CLIP-seq
MIRT2524555	hsa-miR-3117-3p	CLIP-seq
MIRT966455	hsa-miR-3120-3p	CLIP-seq
MIRT2680177	hsa-miR-3145-3p	CLIP-seq
MIRT966458	hsa-miR-3148	CLIP-seq
MIRT1986250	hsa-miR-3158-5p	CLIP-seq
MIRT2680178	hsa-miR-3165	CLIP-seq
MIRT1986252	hsa-miR-3194-3p	CLIP-seq
MIRT966461	hsa-miR-329	CLIP-seq
MIRT966465	hsa-miR-34a	CLIP-seq
MIRT2680179	hsa-miR-34c-3p	CLIP-seq
MIRT966466	hsa-miR-34c-5p	CLIP-seq
MIRT2524557	hsa-miR-3613-3p	CLIP-seq
MIRT2680180	hsa-miR-3622b-5p	CLIP-seq
MIRT966470	hsa-miR-362-3p	CLIP-seq
MIRT1986260	hsa-miR-3678-3p	CLIP-seq
MIRT2524558	hsa-miR-3688-3p	CLIP-seq
MIRT2680181	hsa-miR-3689a-3p	CLIP-seq
MIRT2680182	hsa-miR-3689a-5p	CLIP-seq
MIRT2680183	hsa-miR-3689b	CLIP-seq
MIRT2680184	hsa-miR-3689c	CLIP-seq
MIRT2680185	hsa-miR-3689e	CLIP-seq
MIRT2680186	hsa-miR-3689f	CLIP-seq
MIRT1986262	hsa-miR-3907	CLIP-seq
MIRT966481	hsa-miR-3941	CLIP-seq
MIRT966484	hsa-miR-421	CLIP-seq
MIRT966485	hsa-miR-4255	CLIP-seq
MIRT966486	hsa-miR-4257	CLIP-seq
MIRT966488	hsa-miR-4272	CLIP-seq
MIRT2524559	hsa-miR-4276	CLIP-seq
MIRT2524560	hsa-miR-4301	CLIP-seq
MIRT966493	hsa-miR-4302	CLIP-seq
MIRT2524561	hsa-miR-4311	CLIP-seq
MIRT2428607	hsa-miR-4434	CLIP-seq
MIRT2680187	hsa-miR-4456	CLIP-seq
MIRT2524563	hsa-miR-4474-5p	CLIP-seq
MIRT966500	hsa-miR-448	CLIP-seq
MIRT1986267	hsa-miR-4487	CLIP-seq
MIRT966502	hsa-miR-449a	CLIP-seq
MIRT966503	hsa-miR-449b	CLIP-seq
MIRT966504	hsa-miR-449c	CLIP-seq
MIRT2428608	hsa-miR-4516	CLIP-seq
MIRT2428609	hsa-miR-4531	CLIP-seq
MIRT966508	hsa-miR-4652-3p	CLIP-seq
MIRT2524565	hsa-miR-4662a-3p	CLIP-seq
MIRT2524567	hsa-miR-4667-5p	CLIP-seq
MIRT2680188	hsa-miR-4677-3p	CLIP-seq
MIRT2680189	hsa-miR-4679	CLIP-seq
MIRT2220861	hsa-miR-4680-5p	CLIP-seq
MIRT2524568	hsa-miR-4690-3p	CLIP-seq
MIRT2524569	hsa-miR-4700-5p	CLIP-seq
MIRT2524570	hsa-miR-4722-5p	CLIP-seq
MIRT2428610	hsa-miR-4728-3p	CLIP-seq
MIRT1986270	hsa-miR-4729	CLIP-seq
MIRT2680190	hsa-miR-4738-3p	CLIP-seq
MIRT2220862	hsa-miR-4773	CLIP-seq
MIRT966521	hsa-miR-4789-3p	CLIP-seq
MIRT2524571	hsa-miR-486-3p	CLIP-seq
MIRT2524572	hsa-miR-491-3p	CLIP-seq
MIRT966528	hsa-miR-515-5p	CLIP-seq
MIRT2524574	hsa-miR-521	CLIP-seq
MIRT966531	hsa-miR-545	CLIP-seq
MIRT2524575	hsa-miR-548aa	CLIP-seq
MIRT966533	hsa-miR-548l	CLIP-seq
MIRT966534	hsa-miR-548n	CLIP-seq
MIRT966535	hsa-miR-548o	CLIP-seq
MIRT1986273	hsa-miR-548q	CLIP-seq
MIRT2524576	hsa-miR-570	CLIP-seq
MIRT2680191	hsa-miR-582-3p	CLIP-seq
MIRT966539	hsa-miR-603	CLIP-seq
MIRT2524578	hsa-miR-637	CLIP-seq
MIRT1986278	hsa-miR-642b	CLIP-seq
MIRT1986280	hsa-miR-760	CLIP-seq
MIRT966544	hsa-miR-885-3p	CLIP-seq

Show/Hide all(132)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000290	Process	Deadenylation-dependent decapping of nuclear-transcribed mRNA	IDA	31439799
GO:0001540	Function	Amyloid-beta binding	TAS	26871627
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	ISS	31439799
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	IEA
GO:0005003	Function	Ephrin receptor activity	IDA	12775584
GO:0005003	Function	Ephrin receptor activity	IEA
GO:0005004	Function	GPI-linked ephrin receptor activity	IEA
GO:0005004	Function	GPI-linked ephrin receptor activity	ISS
GO:0005005	Function	Transmembrane-ephrin receptor activity	IBA
GO:0005005	Function	Transmembrane-ephrin receptor activity	IEA
GO:0005005	Function	Transmembrane-ephrin receptor activity	ISS
GO:0005515	Function	Protein binding	IPI	12775584, 19836338, 23812375, 28514442, 33961781, 35384245
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	NAS	24217950
GO:0005886	Component	Plasma membrane	TAS
GO:0005912	Component	Adherens junction	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007162	Process	Negative regulation of cell adhesion	IMP	29093007
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0007411	Process	Axon guidance	IBA
GO:0007411	Process	Axon guidance	IEA
GO:0007628	Process	Adult walking behavior	IEA
GO:0008045	Process	Motor neuron axon guidance	IEA
GO:0008045	Process	Motor neuron axon guidance	ISS
GO:0008284	Process	Positive regulation of cell population proliferation	IGI	28795314
GO:0008347	Process	Glial cell migration	IEA
GO:0009986	Component	Cell surface	IEA
GO:0010719	Process	Negative regulation of epithelial to mesenchymal transition	IMP	29093007
GO:0010977	Process	Negative regulation of neuron projection development	IEA
GO:0010977	Process	Negative regulation of neuron projection development	ISS
GO:0014069	Component	Postsynaptic density	IEA
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016301	Function	Kinase activity	IGI	24217950
GO:0016740	Function	Transferase activity	IEA
GO:0017148	Process	Negative regulation of translation	IDA	31439799
GO:0017148	Process	Negative regulation of translation	ISS	31439799
GO:0021957	Process	Corticospinal tract morphogenesis	IEA
GO:0021957	Process	Corticospinal tract morphogenesis	ISS
GO:0030175	Component	Filopodium	IEA
GO:0030335	Process	Positive regulation of cell migration	IDA	28795314
GO:0030336	Process	Negative regulation of cell migration	IMP	22996586, 29093007
GO:0030424	Component	Axon	IEA
GO:0030424	Component	Axon	ISS
GO:0030425	Component	Dendrite	IBA
GO:0030425	Component	Dendrite	IEA
GO:0030425	Component	Dendrite	ISS
GO:0031594	Component	Neuromuscular junction	IEA
GO:0031901	Component	Early endosome membrane	IEA
GO:0031901	Component	Early endosome membrane	ISS
GO:0034332	Process	Adherens junction organization	IEA
GO:0042731	Function	PH domain binding	IPI	12775584
GO:0042734	Component	Presynaptic membrane	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043087	Process	Regulation of GTPase activity	ISS
GO:0043197	Component	Dendritic spine	IEA
GO:0043197	Component	Dendritic spine	ISS
GO:0043198	Component	Dendritic shaft	IEA
GO:0043198	Component	Dendritic shaft	ISS
GO:0043204	Component	Perikaryon	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0043679	Component	Axon terminus	IEA
GO:0044295	Component	Axonal growth cone	IEA
GO:0044297	Component	Cell body	IEA
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0045785	Process	Positive regulation of cell adhesion	IMP	22996586
GO:0045947	Process	Negative regulation of translational initiation	IDA	30765518
GO:0046330	Process	Positive regulation of JNK cascade	IEA
GO:0046875	Function	Ephrin receptor binding	IEA
GO:0048013	Process	Ephrin receptor signaling pathway	IBA
GO:0048013	Process	Ephrin receptor signaling pathway	IDA	12775584
GO:0048013	Process	Ephrin receptor signaling pathway	IEA
GO:0048013	Process	Ephrin receptor signaling pathway	IGI	24217950
GO:0048013	Process	Ephrin receptor signaling pathway	ISS
GO:0048681	Process	Negative regulation of axon regeneration	IEA
GO:0048681	Process	Negative regulation of axon regeneration	ISS
GO:0048710	Process	Regulation of astrocyte differentiation	IEA
GO:0048710	Process	Regulation of astrocyte differentiation	ISS
GO:0050770	Process	Regulation of axonogenesis	IEA
GO:0050770	Process	Regulation of axonogenesis	ISS
GO:0050775	Process	Positive regulation of dendrite morphogenesis	IEA
GO:0050821	Process	Protein stabilization	IGI	24217950
GO:0060384	Process	Innervation	IEA
GO:0061001	Process	Regulation of dendritic spine morphogenesis	IEA
GO:0061001	Process	Regulation of dendritic spine morphogenesis	ISS
GO:0070161	Component	Anchoring junction	IEA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IDA	29093007
GO:0072178	Process	Nephric duct morphogenesis	IEA
GO:0090102	Process	Cochlea development	IEA
GO:0097155	Process	Fasciculation of sensory neuron axon	IEA
GO:0097155	Process	Fasciculation of sensory neuron axon	ISS
GO:0097156	Process	Fasciculation of motor neuron axon	IEA
GO:0097156	Process	Fasciculation of motor neuron axon	ISS
GO:0097161	Function	DH domain binding	IDA	12775584
GO:0097485	Process	Neuron projection guidance	IEA
GO:0097485	Process	Neuron projection guidance	ISS
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0098839	Component	Postsynaptic density membrane	IEA
GO:0098883	Process	Synapse pruning	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0106030	Process	Neuron projection fasciculation	IEA
GO:0106030	Process	Neuron projection fasciculation	ISS
GO:0140694	Process	Membraneless organelle assembly	IDA	31439799
GO:1900038	Process	Negative regulation of cellular response to hypoxia	IMP	31150684
GO:1900272	Process	Negative regulation of long-term synaptic potentiation	IEA
GO:1900272	Process	Negative regulation of long-term synaptic potentiation	ISS
GO:1902004	Process	Positive regulation of amyloid-beta formation	IGI	24217950
GO:1902533	Process	Positive regulation of intracellular signal transduction	IEA
GO:1902533	Process	Positive regulation of intracellular signal transduction	ISS
GO:1902993	Process	Positive regulation of amyloid precursor protein catabolic process	IGI	24217950
GO:1903051	Process	Negative regulation of proteolysis involved in protein catabolic process	IGI	24217950
GO:1904646	Process	Cellular response to amyloid-beta	IEA
GO:1904646	Process	Cellular response to amyloid-beta	ISS
GO:1905244	Process	Regulation of modification of synaptic structure	IEA
GO:1905244	Process	Regulation of modification of synaptic structure	ISS
GO:1905806	Process	Regulation of synapse pruning	IEA
GO:1990782	Function	Protein tyrosine kinase binding	IPI	24217950

MIM	HGNC	e!Ensembl
602188	3388	ENSG00000116106

Protein

UniProt ID

P54764

Protein name

Ephrin type-A receptor 4 (EC 2.7.10.1) (EPH-like kinase 8) (EK8) (hEK8) (Tyrosine-protein kinase TYRO1) (Tyrosine-protein kinase receptor SEK)

Protein function

Receptor tyrosine kinase which binds membrane-bound ephrin family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as

PDB

2LW8 , 2WO1 , 2WO2 , 2WO3 , 3CKH , 3GXU , 4BK4 , 4BK5 , 4BKA , 4BKF , 4M4P , 4M4R , 4W4Z , 4W50 , 5JR2 , 7OFV , 9CY8

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01404	Ephrin_lbd	31 → 204	Ephrin receptor ligand binding domain	Domain
PF00041	fn3	330 → 424	Fibronectin type III domain	Domain
PF00041	fn3	442 → 525	Fibronectin type III domain	Domain
PF14575	EphA2_TM	548 → 618	Ephrin type-A receptor 2 transmembrane domain	Domain
PF07714	PK_Tyr_Ser-Thr	621 → 878	Protein tyrosine and serine/threonine kinase	Domain
PF07647	SAM_2	908 → 973	SAM domain (Sterile alpha motif)	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:7898931}.

Sequence

MAGIFYFALFSCLFGICDAVTGSRVYPANEVTLLDSRSVQGELGWIASPLEGGWEEVSIM
DEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKE
TFNLYYYESDNDKERFIRENQFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKG
FYLAFQDVGACIALVSVRVFYKKCPLTVRNLAQFPDTITGADTSSLVEVRGSCVNNSEEK
DVPKMYCGADGEWLVPIGNCLCNAGHEERSGECQACKIGYYKALSTDATCAKCPPHSYSV
WEGATSCTCDRGFFRADNDAASMPCTRPPSAPLNLISNVNETSVNLEWSSPQNTGGRQDI
SYNVVCKKCGAGDPSKCRPCGSGVHYTPQQNGLKTTKVSITDLLAHTNYTFEIWAVNGVS
KYNPNPDQSVSVTVTTNQAAPSSIALVQAKEVTRYSVALAWLEPDRPNGVILEYEVKYYE
KDQNERSYRIVRTAARNTDIKGLNPLTSYVFHVRARTAAGYGDFSEPLEVTTNTVPSRII
GDGANSTVLLVSVSGSVVLVVILIAAFVISRRRSKYSKAKQEADEEKHLNQGVRTYVDPF
TYEDPNQAVREFAKEIDASCIKIEKVIGVGEFGEVCSGRLKVPGKREICVAIKTLKAGYT
DKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTV
IQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLEDDPEAAYT
TRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEG
YRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQIVNMLDKLIRNPNSLKRTGTESSRPNT
ALLDPSSPEFSAVVSVGDWLQAIKMDRYKDNFTAAGYTTLEAVVHVNQEDLARIGITAIT
HQNKILSSVQAMRTQMQQMHGRMVPV

Sequence length

986

Interactions

View interactions

	KEGG		Reactome
	Axon guidance		EPH-Ephrin signaling EPHA-mediated growth cone collapse EPH-ephrin mediated repulsion of cells

Show/Hide Unknown Diseases (4)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Neurodevelopmental Disorders	complex neurodevelopmental disorder	N/A	N/A	GenCC
Neuroticism	Neuroticism	N/A	N/A	GWAS
Oligodendroglioma	Oligodendroglioma	N/A	N/A	GWAS
Rheumatoid arthritis	Rheumatoid arthritis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (39)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	22807579
Adenoma	Associate	30175151
Amyotrophic Lateral Sclerosis	Associate	23991104, 26497046
Autism Spectrum Disorder	Associate	38057311
Breast Neoplasms	Associate	29101386, 33977106
Carcinogenesis	Associate	34139238
Carcinoma Pancreatic Ductal	Associate	16965393
Colorectal Neoplasms	Associate	30097457
Epstein Barr Virus Infections	Inhibit	27338098
Glioma	Associate	37192718
HIV Infections	Inhibit	23314923
Infections	Associate	29899108, 30782663
Leukemia Myeloid Acute	Associate	24764074
Lupus Erythematosus Systemic	Associate	31536674
Lupus Erythematosus Systemic	Inhibit	35462789
Lymphatic Metastasis	Inhibit	24022400
Lymphoma B Cell	Associate	27338098
Lymphoma B Cell Marginal Zone	Inhibit	28887496
Lymphoma Large B Cell Diffuse	Associate	27338098
Lymphoma Large B Cell Diffuse	Inhibit	37976136
Lymphoma T Cell	Associate	26376612
Melanoma	Associate	34139238
Multiple Myeloma	Associate	28351297
Multiple Sclerosis	Associate	15779235
Neoplasms	Associate	18837080, 22807579, 26376612, 28351297, 29101386, 30175151, 33977106, 34139238, 36804938, 38124114
Neurodegenerative Diseases	Associate	34139238
Osteoarthritis	Associate	23546957
Pancreatic Neoplasms	Associate	16965393, 19949912
Parkinson Disease	Associate	25556233
Pituitary Neoplasms	Associate	33168897
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	39453390
Prostatitis	Associate	8650201
Respiratory Tract Infections	Associate	35212764
Sezary Syndrome	Associate	26376612
Smoke Inhalation Injury	Associate	28816646
Spinal Cord Injuries	Associate	33595805
Squamous Cell Carcinoma of Head and Neck	Associate	24022400, 36362284, 36804938
Stomach Neoplasms	Associate	18837080
Tuberculosis Meningeal	Associate	34685683

EPHA4 (EPH receptor A4)