Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2042
Gene name Gene Name - the full gene name approved by the HGNC.	EPH receptor A3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	EPHA3
Synonyms (NCBI Gene) Gene synonyms aliases	EK4, ETK, ETK1, HEK, HEK4, TYRO4
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3p11.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically ha

Show/Hide all(52)

miRTarBase ID	miRNA	Experiments
MIRT966382	hsa-miR-1322	CLIP-seq
MIRT966383	hsa-miR-135a	CLIP-seq
MIRT966384	hsa-miR-135b	CLIP-seq
MIRT966385	hsa-miR-23a	CLIP-seq
MIRT966386	hsa-miR-23b	CLIP-seq
MIRT966387	hsa-miR-23c	CLIP-seq
MIRT966388	hsa-miR-3121-3p	CLIP-seq
MIRT966389	hsa-miR-3692	CLIP-seq
MIRT966390	hsa-miR-3910	CLIP-seq
MIRT966391	hsa-miR-3922-5p	CLIP-seq
MIRT966392	hsa-miR-4297	CLIP-seq
MIRT966393	hsa-miR-4691-3p	CLIP-seq
MIRT966394	hsa-miR-4729	CLIP-seq
MIRT966395	hsa-miR-4789-5p	CLIP-seq
MIRT966396	hsa-miR-4802-3p	CLIP-seq
MIRT966397	hsa-miR-1257	CLIP-seq
MIRT966398	hsa-miR-203	CLIP-seq
MIRT966399	hsa-miR-3200-5p	CLIP-seq
MIRT966400	hsa-miR-3616-5p	CLIP-seq
MIRT966401	hsa-miR-3647-5p	CLIP-seq
MIRT966402	hsa-miR-3682-5p	CLIP-seq
MIRT966403	hsa-miR-4427	CLIP-seq
MIRT966404	hsa-miR-4680-3p	CLIP-seq
MIRT966405	hsa-miR-4766-5p	CLIP-seq
MIRT966406	hsa-miR-4795-5p	CLIP-seq
MIRT966407	hsa-miR-573	CLIP-seq
MIRT966398	hsa-miR-203	CLIP-seq
MIRT966399	hsa-miR-3200-5p	CLIP-seq
MIRT966405	hsa-miR-4766-5p	CLIP-seq
MIRT966398	hsa-miR-203	CLIP-seq
MIRT966399	hsa-miR-3200-5p	CLIP-seq
MIRT966405	hsa-miR-4766-5p	CLIP-seq
MIRT1986233	hsa-miR-3646	CLIP-seq
MIRT1986234	hsa-miR-3929	CLIP-seq
MIRT1986235	hsa-miR-4311	CLIP-seq
MIRT1986236	hsa-miR-4419b	CLIP-seq
MIRT1986237	hsa-miR-4478	CLIP-seq
MIRT1986235	hsa-miR-4311	CLIP-seq
MIRT2220852	hsa-miR-545	CLIP-seq
MIRT2428606	hsa-miR-586	CLIP-seq
MIRT2437018	hsa-miR-208a	CLIP-seq
MIRT2437019	hsa-miR-208b	CLIP-seq
MIRT2437020	hsa-miR-3617	CLIP-seq
MIRT2437021	hsa-miR-4666-5p	CLIP-seq
MIRT2437022	hsa-miR-499-5p	CLIP-seq
MIRT2437023	hsa-miR-641	CLIP-seq
MIRT2465229	hsa-miR-198	CLIP-seq
MIRT2524546	hsa-miR-1305	CLIP-seq
MIRT2524547	hsa-miR-607	CLIP-seq
MIRT2524546	hsa-miR-1305	CLIP-seq
MIRT2680175	hsa-miR-3613-3p	CLIP-seq
MIRT2524547	hsa-miR-607	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
AES	Unknown	20676368

Show/Hide all(42)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	IEA
GO:0005003	Function	Ephrin receptor activity	IDA	11519828
GO:0005003	Function	Ephrin receptor activity	IEA
GO:0005004	Function	GPI-linked ephrin receptor activity	IDA	11870224
GO:0005005	Function	Transmembrane-ephrin receptor activity	IBA
GO:0005515	Function	Protein binding	IPI	11519828, 11870224, 21135139, 22036564, 33961781, 35384245, 35512704
GO:0005524	Function	ATP binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005769	Component	Early endosome	IDA	21135139
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	11870224, 21135139
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007155	Process	Cell adhesion	IEA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IEA
GO:0007411	Process	Axon guidance	IBA
GO:0010717	Process	Regulation of epithelial to mesenchymal transition	ISS
GO:0010976	Process	Positive regulation of neuron projection development	IMP	17910947
GO:0015629	Component	Actin cytoskeleton	IDA
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016477	Process	Cell migration	ISS
GO:0016740	Function	Transferase activity	IEA
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IDA
GO:0030425	Component	Dendrite	IBA
GO:0031965	Component	Nuclear membrane	IDA
GO:0032956	Process	Regulation of actin cytoskeleton organization	IDA	11870224
GO:0043087	Process	Regulation of GTPase activity	IDA	11870224
GO:0045806	Process	Negative regulation of endocytosis	IDA
GO:0048013	Process	Ephrin receptor signaling pathway	IBA
GO:0048013	Process	Ephrin receptor signaling pathway	IDA	11870224
GO:0051893	Process	Regulation of focal adhesion assembly	IDA	11870224
GO:0070507	Process	Regulation of microtubule cytoskeleton organization	IDA	11870224
GO:0071300	Process	Cellular response to retinoic acid	IMP	17910947
GO:0097155	Process	Fasciculation of sensory neuron axon	ISS
GO:0097156	Process	Fasciculation of motor neuron axon	ISS
GO:1903078	Process	Positive regulation of protein localization to plasma membrane	IDA

MIM	HGNC	e!Ensembl
179611	3387	ENSG00000044524

Protein

UniProt ID

P29320

Protein name

Ephrin type-A receptor 3 (EC 2.7.10.1) (EPH-like kinase 4) (EK4) (hEK4) (HEK) (Human embryo kinase) (Tyrosine-protein kinase TYRO4) (Tyrosine-protein kinase receptor ETK1) (Eph-like tyrosine kinase 1)

Protein function

Receptor tyrosine kinase which binds promiscuously membrane-bound ephrin family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is

PDB

2GSF , 2QO2 , 2QO7 , 2QO9 , 2QOB , 2QOC , 2QOD , 2QOF , 2QOI , 2QOK , 2QOL , 2QON , 2QOO , 2QOQ , 3DZQ , 3FXX , 3FY2 , 4G2F , 4GK2 , 4GK3 , 4GK4 , 4L0P , 4P4C , 4P5Q , 4P5Z , 4TWN , 4TWO , 6IN0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01404	Ephrin_lbd	30 → 202	Ephrin receptor ligand binding domain	Domain
PF07699	Ephrin_rec_like	263 → 306	Putative ephrin-receptor like	Family
PF00041	fn3	327 → 422	Fibronectin type III domain	Domain
PF00041	fn3	437 → 521	Fibronectin type III domain	Domain
PF14575	EphA2_TM	542 → 618	Ephrin type-A receptor 2 transmembrane domain	Domain
PF07714	PK_Tyr_Ser-Thr	621 → 878	Protein tyrosine and serine/threonine kinase	Domain
PF07647	SAM_2	908 → 973	SAM domain (Sterile alpha motif)	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Highest level in placenta.

Sequence

MDCQLSILLLLSCSVLDSFGELIPQPSNEVNLLDSKTIQGELGWISYPSHGWEEISGVDE
HYTPIRTYQVCNVMDHSQNNWLRTNWVPRNSAQKIYVELKFTLRDCNSIPLVLGTCKETF
NLYYMESDDDHGVKFREHQFTKIDTIAADESFTQMDLGDRILKLNTEIREVGPVNKKGFY
LAFQDVGACVALVSVRVYFKKCPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPP
RMYCSTEGEWLVPIGKCSCNAGYEERGFMCQACRPGFYKALDGNMKCAKCPPHSSTQEDG
SMNCRCENNYFRADKDPPSMACTRPPSSPRNVISNINETSVILDWSWPLDTGGRKDVTFN
IICKKCGWNIKQCEPCSPNVRFLPRQFGLTNTTVTVTDLLAHTNYTFEIDAVNGVSELSS
PPRQFAAVSITTNQAAPSPVLTIKKDRTSRNSISLSWQEPEHPNGIILDYEVKYYEKQEQ
ETSYTILRARGTNVTISSLKPDTIYVFQIRARTAAGYGTNSRKFEFETSPDSFSISGESS
QVVMIAISAAVAIILLTVVIYVLIGRFCGYKSKHGADEKRLHFGNGHLKLPGLRTYVDPH
TYEDPTQAVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYT
EKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTV
IQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYT
TRGGKIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEG
YRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSAAARPSN
LLLDQSNVDITTFRTTGDWLNGVWTAHCKEIFTGVEYSSCDTIAKISTDDMKKVGVTVVG
PQKKIISSIKALETQSKNGPVPV

Sequence length

983

Interactions

View interactions

	KEGG		Reactome
	Axon guidance		EPH-Ephrin signaling EPHA-mediated growth cone collapse EPH-ephrin mediated repulsion of cells

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Atrial Fibrillation	Atrial fibrillation	N/A	N/A	GWAS

Show/Hide Text Mining Associations (36)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	18948947
Amyotrophic Lateral Sclerosis	Inhibit	23991104
Amyotrophic lateral sclerosis 1	Associate	23991104
Autism Spectrum Disorder	Associate	21996756
Breast Neoplasms	Associate	19678838, 21124932, 33977106, 36936167
Carcinogenesis	Associate	20027224, 23324396
Carcinogenesis	Inhibit	20657180
Carcinoma Large Cell	Associate	30793508
Carcinoma Merkel Cell	Associate	36736454
Carcinoma Non Small Cell Lung	Associate	25634010
Carcinoma Squamous Cell	Associate	39694330
Cholangiocarcinoma	Associate	10761710
Colorectal Neoplasms	Associate	22242939
Esophageal Squamous Cell Carcinoma	Associate	21734802
Glioblastoma	Associate	22242939
Glioblastoma	Stimulate	27494882
Head and Neck Neoplasms	Associate	33919657
Hematologic Neoplasms	Associate	10498621
Hereditary Breast and Ovarian Cancer Syndrome	Associate	21124932, 23967248
Lung Neoplasms	Associate	24348920
Melanoma	Associate	21494657, 22242939, 25393105
Multiple Myeloma	Associate	28415715
Multiple Sclerosis	Associate	15779235
Nasopharyngeal Carcinoma	Associate	32633364
Neoplasm Metastasis	Associate	19678838
Neoplasm Metastasis	Stimulate	30958616
Neoplasms	Associate	18948947, 20838624, 21124932, 22242939, 23091610, 23324396, 24348920, 25393105, 27494882, 28776571, 32633364, 33853673, 33919657, 33977106, 35596192, 39694330 View all (1 more)
Neoplasms	Inhibit	20657180
Non alcoholic Fatty Liver Disease	Stimulate	29769552
Ovarian Neoplasms	Associate	26261572
Phyllodes Tumor	Associate	34399808
Prostatic Neoplasms	Associate	28035996, 33107155
Prostatic Neoplasms	Stimulate	30958616
Sexual Dysfunctions Psychological	Associate	26381449
Small Cell Lung Carcinoma	Associate	24978188, 33880365, 35596192
Squamous Cell Carcinoma of Head and Neck	Associate	20657180

EPHA3 (EPH receptor A3)