Gene Gene information from NCBI Gene database.
Entrez ID 202559
Gene name KH RNA binding domain containing, signal transduction associated 2
Gene symbol KHDRBS2
Synonyms (NCBI Gene)
KHDRBS2-OTKHDRBS2-OT1SLM-1SLM1
Chromosome 6
Chromosome location 6q11.1
miRNA miRNA information provided by mirtarbase database.
23
miRTarBase ID miRNA Experiments Reference
MIRT018184 hsa-miR-335-5p Microarray 18185580
MIRT019320 hsa-miR-148b-3p Microarray 17612493
MIRT1085228 hsa-miR-1238 CLIP-seq
MIRT1085229 hsa-miR-3140-3p CLIP-seq
MIRT1085230 hsa-miR-3143 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
15
GO ID Ontology Definition Evidence Reference
GO:0000381 Process Regulation of alternative mRNA splicing, via spliceosome IBA
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding IEA
GO:0003729 Function MRNA binding IBA
GO:0005515 Function Protein binding IPI 16189514, 19282290, 21516116, 25416956, 25910212, 26871637, 27107012, 29892012, 30886144, 31413325, 31515488, 32296183, 33961781
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
610487 18114 ENSG00000112232
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5VWX1
Protein name KH domain-containing, RNA-binding, signal transduction-associated protein 2 (Sam68-like mammalian protein 1) (SLM-1) (hSLM-1)
Protein function RNA-binding protein that plays a role in the regulation of alternative splicing and influences mRNA splice site selection and exon inclusion. Binds both poly(A) and poly(U) homopolymers. Phosphorylation by PTK6 inhibits its RNA-binding ability (
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF16274 Qua1 5 57 Qua1 domain Domain
PF00013 KH_1 61 130 KH domain Domain
PF16568 Sam68-YY 267 321 Tyrosine-rich domain of Sam68 Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in brain, lung, kidney and small intestine. Weakly expressed in placenta, liver, spleen, thymus, ovary and colon. {ECO:0000269|PubMed:12549823}.
Sequence
MEEEKYLPELMAEKDSLDPSFVHASRLLAEEIEKFQGSDGKKEDEEKKYLDVISNKNIKL
SERVLIPVKQYPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKGSMRDKAKEEELRKSG
EAKYAHLSDE
LHVLIEVFAPPGEAYSRMSHALEEIKKFLVPDYNDEIRQEQLRELSYLNG
SEDSGRGRGIRGRGIRIAPTAPSRGRGGAIPPPPPPGRGVLTPRGSTVTRGALPVPPVAR
GVPTPRARGAPTVPGYRAPPPPAHEAYEEYGYDDGYGGEYDDQTYETYDNSYATQTQSVP
EYYDYGHGVSEDAYDSYAPEE
WATTRSSLKAPPQRSARGGYREHPYGRY
Sequence length 349
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    PTK6 Regulates Proteins Involved in RNA Processing