Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
201501
Gene name Gene Name - the full gene name approved by the HGNC.
Zinc finger and BTB domain containing 7C
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZBTB7C
Synonyms (NCBI Gene) Gene synonyms aliases
APM-1, APM1, ZBTB36, ZNF857C
Chromosome Chromosome number
18
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
18q21.1
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT018542 hsa-miR-335-5p Microarray 18185580
MIRT621567 hsa-miR-8485 HITS-CLIP 23824327
MIRT642849 hsa-miR-510-5p HITS-CLIP 23824327
MIRT621566 hsa-miR-1228-3p HITS-CLIP 23824327
MIRT621565 hsa-miR-106b-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0005634 Component Nucleus IEA
GO:0006357 Process Regulation of transcription by RNA polymerase II IBA
GO:0008270 Function Zinc ion binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
616591 31700 ENSG00000184828
Protein
UniProt ID A1YPR0
Protein name Zinc finger and BTB domain-containing protein 7C (Affected by papillomavirus DNA integration in ME180 cells protein 1) (APM-1) (Zinc finger and BTB domain-containing protein 36) (Zinc finger protein 857C)
Protein function May be a tumor suppressor gene.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00651 BTB 24 129 BTB/POZ domain Domain
PF00096 zf-C2H2 392 414 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 448 469 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Detected in normal cervical keratinocytes, and in some cervical carcinoma cell lines. {ECO:0000269|PubMed:9427755}.
Sequence
MANDIDELIGIPFPNHSSEVLCSLNEQRHDGLLCDVLLVVQEQEYRTHRSVLAACSKYFK
KLFTAGTLASQPYVYEIDFVQPEALAAILEFAYTSTLTITAGNVKHILNAARMLEIQCIV
NVCLEIMEP
GGDGGEEDDKEDDDDDEDDDDEEDEEEEEEEEEDDDDDTEDFADQENLPDP
QDISCHQSPSKTDHLTEKAYSDTPRDFPDSFQAGSPGHLGVIRDFSIESLLRENLYPKAN
IPDRRPSLSPFAPDFFPHLWPGDFGAFAQLPEQPMDSGPLDLVIKNRKIKEEEKEELPPP
PPPPFPNDFFKDMFPDLPGGPLGPIKAENDYGAYLNFLSATHLGGLFPPWPLVEERKLKP
KASQQCPICHKVIMGAGKLPRHMRTHTGEKPYMCTICEVRFTRQDKLKIHMRKHTGERPY
LCIHCNAKFVHNYDLKNHMRIHTGVRPYQCEFCYKSFTRSDHLHRHIKRQSCRMARPRRG
RKPAAWRAASLLFGPGGPAPDKAAFVMPPALGEVGGHLGGAAVCLPGPSPAKHFLAAPKG
ALSLQELERQFEETQMKLFGRAQLEAERNAGGLLAFALAENVAAARPYFPLPDPWAAGLA
GLPGLAGLNHVASMSEANN
Sequence length 619
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Asthma (childhood onset), Asthma N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Prostate cancer Prostate cancer N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 32193444
Colonic Neoplasms Associate 33946045
Colorectal Neoplasms Associate 33946045, 37158531
Diabetes Mellitus Type 2 Associate 27374856
Esophageal Neoplasms Stimulate 33946045
Lymphoma Large B Cell Diffuse Associate 33946045
Mesothelioma Associate 33946045
Neoplasms Associate 33946045
Neoplasms Inhibit 9427755
Uterine Cervical Neoplasms Associate 9427755