Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
200942
Gene name Gene Name - the full gene name approved by the HGNC.
Kelch domain containing 8B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KLHDC8B
Synonyms (NCBI Gene) Gene synonyms aliases
CHL
Disease Acronyms (UniProt) Disease acronyms from UniProt database
CHL
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3p21.31
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein which forms a distinct beta-propeller protein structure of kelch domains allowing for protein-protein interactions. Mutations in this gene have been associated with Hodgkin lymphoma. [provided by RefSeq, Sep 2010]
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs387906223 C>T Pathogenic 5 prime UTR variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT019701 hsa-miR-375 Microarray 20215506
MIRT474507 hsa-miR-196a-5p PAR-CLIP 23592263
MIRT474506 hsa-miR-196b-5p PAR-CLIP 23592263
MIRT474505 hsa-let-7a-5p PAR-CLIP 23592263
MIRT474504 hsa-miR-4500 PAR-CLIP 23592263
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005737 Component Cytoplasm IDA 20107318
GO:0005829 Component Cytosol IDA
GO:0030496 Component Midbody IDA 20107318
GO:0045171 Component Intercellular bridge IDA 20107318
GO:0098813 Process Nuclear chromosome segregation IMP 22988245, 23713010
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
613169 28557 ENSG00000185909
Protein
UniProt ID Q8IXV7
Protein name Kelch domain-containing protein 8B
Protein function Involved in pinching off the separated nuclei at the cleavage furrow and in cytokinesis (PubMed:20107318). Required for mitotic integrity and maintenance of chromosomal stability. Protects cells against mitotic errors, centrosomal amplification,
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01344 Kelch_1 20 66 Kelch motif Repeat
PF01344 Kelch_1 68 114 Kelch motif Repeat
PF01344 Kelch_1 164 209 Kelch motif Repeat
PF01344 Kelch_1 270 316 Kelch motif Repeat
Sequence
MSAGGGRAFAWQVFPPMPTCRVYGTVAHQDGHLLVLGGCGRAGLPLDTAETLDMASHTWL
ALAPLP
TARAGAAAVVLGKQVLVVGGVDEVQSPVAAVEAFLMDEGRWERRATLPQAAMGV
ATVERDGMVYALGGMGPDTAPQAQVRVYEPRRDCWLSLPSMPTPCYGASTFLHGNKIYVL
GGRQGKLPVTAFEAFDLEARTWTRHPSLP
SRRAFAGCAMAEGSVFSLGGLQQPGPHNFYS
RPHFVNTVEMFDLEHGSWTKLPRSLRMRDKRADFVVGSLGGHIVAIGGLGNQPCPLGSVE
SFSLARRRWEALPAMP
TARCSCSSLQAGPRLFVIGGVAQGPSQAVEALCLRDGV
Sequence length 354
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Hodgkin lymphoma Adult Hodgkin Lymphoma, Classic Hodgkin lymphoma, nodular sclerosis type ClinVar
Mental depression Major Depressive Disorder 29942085 ClinVar
Lymphoma classic Hodgkin lymphoma GenCC
Mental Depression Mental Depression GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 31132294
Aneuploidy Associate 22988245
Hereditary leiomyomatosis and renal cell cancer Associate 18641027, 20107318
Hodgkin Disease Associate 18641027, 20107318, 22988245, 35977101
Lymphoma B Cell Associate 26599546
Neoplasms Associate 33955587