Gene Gene information from NCBI Gene database.
Entrez ID 200942
Gene name Kelch domain containing 8B
Gene symbol KLHDC8B
Synonyms (NCBI Gene)
CHL
Chromosome 3
Chromosome location 3p21.31
Summary This gene encodes a protein which forms a distinct beta-propeller protein structure of kelch domains allowing for protein-protein interactions. Mutations in this gene have been associated with Hodgkin lymphoma. [provided by RefSeq, Sep 2010]
SNPs SNP information provided by dbSNP.
1
SNP ID Visualize variation Clinical significance Consequence
rs387906223 C>T Pathogenic 5 prime UTR variant
miRNA miRNA information provided by mirtarbase database.
179
miRTarBase ID miRNA Experiments Reference
MIRT019701 hsa-miR-375 Microarray 20215506
MIRT474507 hsa-miR-196a-5p PAR-CLIP 23592263
MIRT474506 hsa-miR-196b-5p PAR-CLIP 23592263
MIRT474505 hsa-let-7a-5p PAR-CLIP 23592263
MIRT474504 hsa-miR-4500 PAR-CLIP 23592263
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
17
GO ID Ontology Definition Evidence Reference
GO:0005737 Component Cytoplasm IDA 20107318
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol IDA
GO:0030496 Component Midbody IBA
GO:0030496 Component Midbody IDA 20107318
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
613169 28557 ENSG00000185909
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8IXV7
Protein name Kelch domain-containing protein 8B
Protein function Involved in pinching off the separated nuclei at the cleavage furrow and in cytokinesis (PubMed:20107318). Required for mitotic integrity and maintenance of chromosomal stability. Protects cells against mitotic errors, centrosomal amplification,
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01344 Kelch_1 20 66 Kelch motif Repeat
PF01344 Kelch_1 68 114 Kelch motif Repeat
PF01344 Kelch_1 164 209 Kelch motif Repeat
PF01344 Kelch_1 270 316 Kelch motif Repeat
Sequence
MSAGGGRAFAWQVFPPMPTCRVYGTVAHQDGHLLVLGGCGRAGLPLDTAETLDMASHTWL
ALAPLP
TARAGAAAVVLGKQVLVVGGVDEVQSPVAAVEAFLMDEGRWERRATLPQAAMGV
ATVERDGMVYALGGMGPDTAPQAQVRVYEPRRDCWLSLPSMPTPCYGASTFLHGNKIYVL
GGRQGKLPVTAFEAFDLEARTWTRHPSLP
SRRAFAGCAMAEGSVFSLGGLQQPGPHNFYS
RPHFVNTVEMFDLEHGSWTKLPRSLRMRDKRADFVVGSLGGHIVAIGGLGNQPCPLGSVE
SFSLARRRWEALPAMP
TARCSCSSLQAGPRLFVIGGVAQGPSQAVEALCLRDGV
Sequence length 354
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
4
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Classic Hodgkin lymphoma Likely benign rs387906223 RCV000000297
KLHDC8B-related disorder Likely benign; Benign rs776104000, rs11713297, rs569675399 RCV003898672
RCV003984325
RCV003902253
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 31132294
Aneuploidy Associate 22988245
Hereditary leiomyomatosis and renal cell cancer Associate 18641027, 20107318
Hodgkin Disease Associate 18641027, 20107318, 22988245, 35977101
Lymphoma B Cell Associate 26599546
Neoplasms Associate 33955587