Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1999
Gene name	E74 like ETS transcription factor 3
Gene symbol	ELF3
Synonyms (NCBI Gene)	EPR-1ERTESE-1ESX
Chromosome	1
Chromosome location	1q32.1

159

Show/Hide all (159)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021421	hsa-miR-9-5p	Microarray	17612493
MIRT023041	hsa-miR-124-3p	Microarray	18668037
MIRT959991	hsa-miR-1207-3p	CLIP-seq
MIRT959992	hsa-miR-1254	CLIP-seq
MIRT959993	hsa-miR-127-5p	CLIP-seq
MIRT959994	hsa-miR-128	CLIP-seq
MIRT959995	hsa-miR-139-5p	CLIP-seq
MIRT959996	hsa-miR-194	CLIP-seq
MIRT959997	hsa-miR-2278	CLIP-seq
MIRT959998	hsa-miR-3116	CLIP-seq
MIRT959999	hsa-miR-3192	CLIP-seq
MIRT960000	hsa-miR-338-5p	CLIP-seq
MIRT960001	hsa-miR-3622b-5p	CLIP-seq
MIRT960002	hsa-miR-3672	CLIP-seq
MIRT960003	hsa-miR-3688-3p	CLIP-seq
MIRT960004	hsa-miR-377	CLIP-seq
MIRT960005	hsa-miR-3974	CLIP-seq
MIRT960006	hsa-miR-4300	CLIP-seq
MIRT960007	hsa-miR-4718	CLIP-seq
MIRT960008	hsa-miR-4720-5p	CLIP-seq
MIRT960009	hsa-miR-4761-5p	CLIP-seq
MIRT960010	hsa-miR-4768-5p	CLIP-seq
MIRT960011	hsa-miR-4786-3p	CLIP-seq
MIRT960012	hsa-miR-4799-3p	CLIP-seq
MIRT960013	hsa-miR-495	CLIP-seq
MIRT960014	hsa-miR-515-3p	CLIP-seq
MIRT960015	hsa-miR-519e	CLIP-seq
MIRT960016	hsa-miR-550a	CLIP-seq
MIRT960017	hsa-miR-607	CLIP-seq
MIRT960018	hsa-miR-660	CLIP-seq
MIRT960019	hsa-miR-661	CLIP-seq
MIRT960020	hsa-miR-668	CLIP-seq
MIRT960021	hsa-miR-920	CLIP-seq
MIRT960022	hsa-miR-942	CLIP-seq
MIRT960023	hsa-miR-1301	CLIP-seq
MIRT960024	hsa-miR-1304	CLIP-seq
MIRT960025	hsa-miR-142-5p	CLIP-seq
MIRT960026	hsa-miR-340	CLIP-seq
MIRT960002	hsa-miR-3672	CLIP-seq
MIRT960027	hsa-miR-4329	CLIP-seq
MIRT960028	hsa-miR-4463	CLIP-seq
MIRT960029	hsa-miR-4660	CLIP-seq
MIRT960030	hsa-miR-5047	CLIP-seq
MIRT960031	hsa-miR-629	CLIP-seq
MIRT1984360	hsa-miR-1184	CLIP-seq
MIRT1984361	hsa-miR-1205	CLIP-seq
MIRT1984362	hsa-miR-1225-3p	CLIP-seq
MIRT1984363	hsa-miR-1231	CLIP-seq
MIRT1984364	hsa-miR-124	CLIP-seq
MIRT959992	hsa-miR-1254	CLIP-seq
MIRT1984365	hsa-miR-1286	CLIP-seq
MIRT1984366	hsa-miR-1296	CLIP-seq
MIRT1984367	hsa-miR-132	CLIP-seq
MIRT1984368	hsa-miR-136	CLIP-seq
MIRT960025	hsa-miR-142-5p	CLIP-seq
MIRT1984369	hsa-miR-1910	CLIP-seq
MIRT1984370	hsa-miR-212	CLIP-seq
MIRT1984371	hsa-miR-2355-5p	CLIP-seq
MIRT1984372	hsa-miR-24	CLIP-seq
MIRT1984373	hsa-miR-2861	CLIP-seq
MIRT959998	hsa-miR-3116	CLIP-seq
MIRT1984374	hsa-miR-3158-5p	CLIP-seq
MIRT1984375	hsa-miR-3183	CLIP-seq
MIRT1984376	hsa-miR-3189-3p	CLIP-seq
MIRT1984377	hsa-miR-3189-5p	CLIP-seq
MIRT959999	hsa-miR-3192	CLIP-seq
MIRT1984378	hsa-miR-338-3p	CLIP-seq
MIRT960026	hsa-miR-340	CLIP-seq
MIRT1984379	hsa-miR-346	CLIP-seq
MIRT1984380	hsa-miR-3664-5p	CLIP-seq
MIRT1984381	hsa-miR-3689d	CLIP-seq
MIRT1984382	hsa-miR-3909	CLIP-seq
MIRT1984383	hsa-miR-3934	CLIP-seq
MIRT1984384	hsa-miR-4264	CLIP-seq
MIRT1984385	hsa-miR-4284	CLIP-seq
MIRT1984386	hsa-miR-4288	CLIP-seq
MIRT960006	hsa-miR-4300	CLIP-seq
MIRT1984387	hsa-miR-4323	CLIP-seq
MIRT1984388	hsa-miR-4443	CLIP-seq
MIRT1984389	hsa-miR-4459	CLIP-seq
MIRT1984390	hsa-miR-4476	CLIP-seq
MIRT1984391	hsa-miR-4512	CLIP-seq
MIRT1984392	hsa-miR-4530	CLIP-seq
MIRT1984393	hsa-miR-455-3p	CLIP-seq
MIRT1984394	hsa-miR-4648	CLIP-seq
MIRT1984395	hsa-miR-4650-5p	CLIP-seq
MIRT1984396	hsa-miR-4654	CLIP-seq
MIRT1984397	hsa-miR-4690-3p	CLIP-seq
MIRT1984398	hsa-miR-4711-5p	CLIP-seq
MIRT1984399	hsa-miR-4722-5p	CLIP-seq
MIRT1984400	hsa-miR-4723-3p	CLIP-seq
MIRT1984401	hsa-miR-4769-5p	CLIP-seq
MIRT1984402	hsa-miR-506	CLIP-seq
MIRT1984403	hsa-miR-593	CLIP-seq
MIRT1984404	hsa-miR-632	CLIP-seq
MIRT960021	hsa-miR-920	CLIP-seq
MIRT2219487	hsa-miR-1	CLIP-seq
MIRT2219488	hsa-miR-1179	CLIP-seq
MIRT1984360	hsa-miR-1184	CLIP-seq
MIRT1984361	hsa-miR-1205	CLIP-seq
MIRT1984362	hsa-miR-1225-3p	CLIP-seq
MIRT1984363	hsa-miR-1231	CLIP-seq
MIRT1984365	hsa-miR-1286	CLIP-seq
MIRT2219489	hsa-miR-1321	CLIP-seq
MIRT2219490	hsa-miR-133a	CLIP-seq
MIRT2219491	hsa-miR-133b	CLIP-seq
MIRT960025	hsa-miR-142-5p	CLIP-seq
MIRT2219492	hsa-miR-206	CLIP-seq
MIRT1984371	hsa-miR-2355-5p	CLIP-seq
MIRT1984373	hsa-miR-2861	CLIP-seq
MIRT1984374	hsa-miR-3158-5p	CLIP-seq
MIRT2219493	hsa-miR-3162-5p	CLIP-seq
MIRT2219494	hsa-miR-3184	CLIP-seq
MIRT1984377	hsa-miR-3189-5p	CLIP-seq
MIRT2219495	hsa-miR-3194-3p	CLIP-seq
MIRT1984378	hsa-miR-338-3p	CLIP-seq
MIRT960026	hsa-miR-340	CLIP-seq
MIRT1984379	hsa-miR-346	CLIP-seq
MIRT2219496	hsa-miR-3545-5p	CLIP-seq
MIRT2219497	hsa-miR-3660	CLIP-seq
MIRT2219498	hsa-miR-3675-3p	CLIP-seq
MIRT2219499	hsa-miR-3680	CLIP-seq
MIRT1984383	hsa-miR-3934	CLIP-seq
MIRT2219500	hsa-miR-423-5p	CLIP-seq
MIRT2219501	hsa-miR-4256	CLIP-seq
MIRT2219502	hsa-miR-4281	CLIP-seq
MIRT1984386	hsa-miR-4288	CLIP-seq
MIRT2219503	hsa-miR-4449	CLIP-seq
MIRT1984389	hsa-miR-4459	CLIP-seq
MIRT1984390	hsa-miR-4476	CLIP-seq
MIRT1984391	hsa-miR-4512	CLIP-seq
MIRT2219504	hsa-miR-4526	CLIP-seq
MIRT2219505	hsa-miR-4529-5p	CLIP-seq
MIRT2219506	hsa-miR-4532	CLIP-seq
MIRT1984393	hsa-miR-455-3p	CLIP-seq
MIRT1984395	hsa-miR-4650-5p	CLIP-seq
MIRT1984397	hsa-miR-4690-3p	CLIP-seq
MIRT1984398	hsa-miR-4711-5p	CLIP-seq
MIRT1984399	hsa-miR-4722-5p	CLIP-seq
MIRT2219507	hsa-miR-4739	CLIP-seq
MIRT2219508	hsa-miR-4756-5p	CLIP-seq
MIRT2219509	hsa-miR-4798-3p	CLIP-seq
MIRT2219510	hsa-miR-613	CLIP-seq
MIRT1984404	hsa-miR-632	CLIP-seq
MIRT2448783	hsa-miR-1287	CLIP-seq
MIRT2448784	hsa-miR-18a	CLIP-seq
MIRT2448785	hsa-miR-18b	CLIP-seq
MIRT2448786	hsa-miR-198	CLIP-seq
MIRT2448787	hsa-miR-2054	CLIP-seq
MIRT2448788	hsa-miR-3135b	CLIP-seq
MIRT1984393	hsa-miR-455-3p	CLIP-seq
MIRT2448789	hsa-miR-4735-3p	CLIP-seq
MIRT2448790	hsa-miR-4779	CLIP-seq
MIRT959991	hsa-miR-1207-3p	CLIP-seq
MIRT959999	hsa-miR-3192	CLIP-seq
MIRT960006	hsa-miR-4300	CLIP-seq
MIRT960010	hsa-miR-4768-5p	CLIP-seq
MIRT960021	hsa-miR-920	CLIP-seq
MIRT960022	hsa-miR-942	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
NFKB1	Unknown	12746898
RELA	Unknown	12746898

Show/Hide all (37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	9234700
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001824	Process	Blastocyst development	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	10821850
GO:0005515	Function	Protein binding	IPI	10391676, 12624109, 15075319, 26977885, 30476274, 32911434
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	9234700
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	IEP	14715662
GO:0009653	Process	Anatomical structure morphogenesis	IEA
GO:0030154	Process	Cell differentiation	IBA
GO:0030154	Process	Cell differentiation	IEA
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	10773884
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	9234700
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0060056	Process	Mammary gland involution	IEA
GO:0060056	Process	Mammary gland involution	ISS
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

MIM	HGNC	e!Ensembl
602191	3318	ENSG00000163435

P78545

Protein name

ETS-related transcription factor Elf-3 (E74-like factor 3) (Epithelial-restricted with serine box) (Epithelium-restricted Ets protein ESX) (Epithelium-specific Ets transcription factor 1) (ESE-1)

Protein function

Transcriptional activator that binds and transactivates ETS sequences containing the consensus nucleotide core sequence GGA[AT]. Acts synergistically with POU2F3 to transactivate the SPRR2A promoter and with RUNX1 to transactivate the ANGPT1 pro

PDB

2E8P

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02198	SAM_PNT	48 → 132	Sterile alpha motif (SAM)/Pointed domain	Domain
PF00178	Ets	274 → 355	Ets-domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed exclusively in tissues containing a high content of terminally differentiated epithelial cells including mammary gland, colon, trachea, kidney, prostate, uterus, stomach and skin. {ECO:0000269|PubMed:9129154, ECO:0000269|PubM

Sequence

MAATCEISNIFSNYFSAMYSSEDSTLASVPPAATFGADDLVLTLSNPQMSLEGTEKASWL
GEQPQFWSKTQVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQ
LHAQLRDLTSSSSDELSWIIELLEKDGMAFQEALDPGPFDQGSPFAQELLDDGQQASPYH
PGSCGAGAPSPGSSDVSTAGTGASRSSHSSDSGGSDVDLDPTDGKLFPSDGFRDCKKGDP
KHGKRKRGRPRKLSKEYWDCLEGKKSKHAPRGTHLWEFIRDILIHPELNEGLMKWENRHE
GVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNSSG
WKEEEVLQSRN

Sequence length

371

Interactions

View interactions

	Reactome
			Pre-NOTCH Transcription and Translation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BILIARY TRACT NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CYSTIC KIDNEY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAPILLARY RENAL CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (50)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma	Associate	24390348, 26804919	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of Lung	Associate	26977885	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Associate	12746898	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Associate	34946850	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	12031094, 15169914, 17172821, 17491012, 21871131, 28247944, 29187433	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	17172821, 34072506, 36329620	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Associate	24694612	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Stimulate	29523781	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Associate	33832503	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Neuroendocrine	Associate	36840413	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	27827952, 29208568, 38169645	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Associate	28199976	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Associate	36329620	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Associate	29550824, 34250664	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cell Transformation Neoplastic	Associate	24694612	★★★★★ ★☆☆☆☆ Found in Text Mining only
Collagen Diseases	Associate	34250664	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	19074849, 24874735, 33402466	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endotoxemia	Associate	11036073	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial cylindromatosis	Associate	31409603	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis	Associate	34237252	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Associate	32839463	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Associate	33014189	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IV	Associate	35216615	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydroa Vacciniforme	Associate	32682634	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Stimulate	35607962	★★★★★ ★☆☆☆☆ Found in Text Mining only
IgA Vasculitis	Associate	12746898	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	11036073, 26185364, 29550824, 36329620	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Stimulate	33144684	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Associate	26185364	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	34830169	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Associate	27827952	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Stimulate	29208568	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	12031094, 12242338, 24874735, 26804919, 26806338, 26856686, 26977885, 29208568, 30620386, 30665374, 31104013, 32839463, 33144684, 34072506, 36329620, 36840413, 38169645 View all (2 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	20479932, 33618713, 34562599	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Stimulate	27827952	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Associate	29550824	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Associate	12746898, 26603474, 29550824	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	28199976, 33493131, 38025760	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	26856686	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Stimulate	35472129	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatitis	Associate	20479932, 35472129	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Associate	12414507	★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Associate	11073819	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Associate	35258410	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	33618713, 36457025, 39350044	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymic epithelial tumor	Associate	30832724	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ureteral Neoplasms	Associate	36818471	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Associate	27699256, 31104013, 31233191, 34562599	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Associate	36951594	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Associate	35607962	★★★★★ ★☆☆☆☆ Found in Text Mining only

ELF3 (E74 like ETS transcription factor 3)