Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1999
Gene name Gene Name - the full gene name approved by the HGNC.	E74 like ETS transcription factor 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ELF3
Synonyms (NCBI Gene) Gene synonyms aliases	EPR-1, ERT, ESE-1, ESX
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q32.1

Show/Hide all(159)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021421	hsa-miR-9-5p	Microarray	17612493
MIRT023041	hsa-miR-124-3p	Microarray	18668037
MIRT959991	hsa-miR-1207-3p	CLIP-seq
MIRT959992	hsa-miR-1254	CLIP-seq
MIRT959993	hsa-miR-127-5p	CLIP-seq
MIRT959994	hsa-miR-128	CLIP-seq
MIRT959995	hsa-miR-139-5p	CLIP-seq
MIRT959996	hsa-miR-194	CLIP-seq
MIRT959997	hsa-miR-2278	CLIP-seq
MIRT959998	hsa-miR-3116	CLIP-seq
MIRT959999	hsa-miR-3192	CLIP-seq
MIRT960000	hsa-miR-338-5p	CLIP-seq
MIRT960001	hsa-miR-3622b-5p	CLIP-seq
MIRT960002	hsa-miR-3672	CLIP-seq
MIRT960003	hsa-miR-3688-3p	CLIP-seq
MIRT960004	hsa-miR-377	CLIP-seq
MIRT960005	hsa-miR-3974	CLIP-seq
MIRT960006	hsa-miR-4300	CLIP-seq
MIRT960007	hsa-miR-4718	CLIP-seq
MIRT960008	hsa-miR-4720-5p	CLIP-seq
MIRT960009	hsa-miR-4761-5p	CLIP-seq
MIRT960010	hsa-miR-4768-5p	CLIP-seq
MIRT960011	hsa-miR-4786-3p	CLIP-seq
MIRT960012	hsa-miR-4799-3p	CLIP-seq
MIRT960013	hsa-miR-495	CLIP-seq
MIRT960014	hsa-miR-515-3p	CLIP-seq
MIRT960015	hsa-miR-519e	CLIP-seq
MIRT960016	hsa-miR-550a	CLIP-seq
MIRT960017	hsa-miR-607	CLIP-seq
MIRT960018	hsa-miR-660	CLIP-seq
MIRT960019	hsa-miR-661	CLIP-seq
MIRT960020	hsa-miR-668	CLIP-seq
MIRT960021	hsa-miR-920	CLIP-seq
MIRT960022	hsa-miR-942	CLIP-seq
MIRT960023	hsa-miR-1301	CLIP-seq
MIRT960024	hsa-miR-1304	CLIP-seq
MIRT960025	hsa-miR-142-5p	CLIP-seq
MIRT960026	hsa-miR-340	CLIP-seq
MIRT960002	hsa-miR-3672	CLIP-seq
MIRT960027	hsa-miR-4329	CLIP-seq
MIRT960028	hsa-miR-4463	CLIP-seq
MIRT960029	hsa-miR-4660	CLIP-seq
MIRT960030	hsa-miR-5047	CLIP-seq
MIRT960031	hsa-miR-629	CLIP-seq
MIRT1984360	hsa-miR-1184	CLIP-seq
MIRT1984361	hsa-miR-1205	CLIP-seq
MIRT1984362	hsa-miR-1225-3p	CLIP-seq
MIRT1984363	hsa-miR-1231	CLIP-seq
MIRT1984364	hsa-miR-124	CLIP-seq
MIRT959992	hsa-miR-1254	CLIP-seq
MIRT1984365	hsa-miR-1286	CLIP-seq
MIRT1984366	hsa-miR-1296	CLIP-seq
MIRT1984367	hsa-miR-132	CLIP-seq
MIRT1984368	hsa-miR-136	CLIP-seq
MIRT960025	hsa-miR-142-5p	CLIP-seq
MIRT1984369	hsa-miR-1910	CLIP-seq
MIRT1984370	hsa-miR-212	CLIP-seq
MIRT1984371	hsa-miR-2355-5p	CLIP-seq
MIRT1984372	hsa-miR-24	CLIP-seq
MIRT1984373	hsa-miR-2861	CLIP-seq
MIRT959998	hsa-miR-3116	CLIP-seq
MIRT1984374	hsa-miR-3158-5p	CLIP-seq
MIRT1984375	hsa-miR-3183	CLIP-seq
MIRT1984376	hsa-miR-3189-3p	CLIP-seq
MIRT1984377	hsa-miR-3189-5p	CLIP-seq
MIRT959999	hsa-miR-3192	CLIP-seq
MIRT1984378	hsa-miR-338-3p	CLIP-seq
MIRT960026	hsa-miR-340	CLIP-seq
MIRT1984379	hsa-miR-346	CLIP-seq
MIRT1984380	hsa-miR-3664-5p	CLIP-seq
MIRT1984381	hsa-miR-3689d	CLIP-seq
MIRT1984382	hsa-miR-3909	CLIP-seq
MIRT1984383	hsa-miR-3934	CLIP-seq
MIRT1984384	hsa-miR-4264	CLIP-seq
MIRT1984385	hsa-miR-4284	CLIP-seq
MIRT1984386	hsa-miR-4288	CLIP-seq
MIRT960006	hsa-miR-4300	CLIP-seq
MIRT1984387	hsa-miR-4323	CLIP-seq
MIRT1984388	hsa-miR-4443	CLIP-seq
MIRT1984389	hsa-miR-4459	CLIP-seq
MIRT1984390	hsa-miR-4476	CLIP-seq
MIRT1984391	hsa-miR-4512	CLIP-seq
MIRT1984392	hsa-miR-4530	CLIP-seq
MIRT1984393	hsa-miR-455-3p	CLIP-seq
MIRT1984394	hsa-miR-4648	CLIP-seq
MIRT1984395	hsa-miR-4650-5p	CLIP-seq
MIRT1984396	hsa-miR-4654	CLIP-seq
MIRT1984397	hsa-miR-4690-3p	CLIP-seq
MIRT1984398	hsa-miR-4711-5p	CLIP-seq
MIRT1984399	hsa-miR-4722-5p	CLIP-seq
MIRT1984400	hsa-miR-4723-3p	CLIP-seq
MIRT1984401	hsa-miR-4769-5p	CLIP-seq
MIRT1984402	hsa-miR-506	CLIP-seq
MIRT1984403	hsa-miR-593	CLIP-seq
MIRT1984404	hsa-miR-632	CLIP-seq
MIRT960021	hsa-miR-920	CLIP-seq
MIRT2219487	hsa-miR-1	CLIP-seq
MIRT2219488	hsa-miR-1179	CLIP-seq
MIRT1984360	hsa-miR-1184	CLIP-seq
MIRT1984361	hsa-miR-1205	CLIP-seq
MIRT1984362	hsa-miR-1225-3p	CLIP-seq
MIRT1984363	hsa-miR-1231	CLIP-seq
MIRT1984365	hsa-miR-1286	CLIP-seq
MIRT2219489	hsa-miR-1321	CLIP-seq
MIRT2219490	hsa-miR-133a	CLIP-seq
MIRT2219491	hsa-miR-133b	CLIP-seq
MIRT960025	hsa-miR-142-5p	CLIP-seq
MIRT2219492	hsa-miR-206	CLIP-seq
MIRT1984371	hsa-miR-2355-5p	CLIP-seq
MIRT1984373	hsa-miR-2861	CLIP-seq
MIRT1984374	hsa-miR-3158-5p	CLIP-seq
MIRT2219493	hsa-miR-3162-5p	CLIP-seq
MIRT2219494	hsa-miR-3184	CLIP-seq
MIRT1984377	hsa-miR-3189-5p	CLIP-seq
MIRT2219495	hsa-miR-3194-3p	CLIP-seq
MIRT1984378	hsa-miR-338-3p	CLIP-seq
MIRT960026	hsa-miR-340	CLIP-seq
MIRT1984379	hsa-miR-346	CLIP-seq
MIRT2219496	hsa-miR-3545-5p	CLIP-seq
MIRT2219497	hsa-miR-3660	CLIP-seq
MIRT2219498	hsa-miR-3675-3p	CLIP-seq
MIRT2219499	hsa-miR-3680	CLIP-seq
MIRT1984383	hsa-miR-3934	CLIP-seq
MIRT2219500	hsa-miR-423-5p	CLIP-seq
MIRT2219501	hsa-miR-4256	CLIP-seq
MIRT2219502	hsa-miR-4281	CLIP-seq
MIRT1984386	hsa-miR-4288	CLIP-seq
MIRT2219503	hsa-miR-4449	CLIP-seq
MIRT1984389	hsa-miR-4459	CLIP-seq
MIRT1984390	hsa-miR-4476	CLIP-seq
MIRT1984391	hsa-miR-4512	CLIP-seq
MIRT2219504	hsa-miR-4526	CLIP-seq
MIRT2219505	hsa-miR-4529-5p	CLIP-seq
MIRT2219506	hsa-miR-4532	CLIP-seq
MIRT1984393	hsa-miR-455-3p	CLIP-seq
MIRT1984395	hsa-miR-4650-5p	CLIP-seq
MIRT1984397	hsa-miR-4690-3p	CLIP-seq
MIRT1984398	hsa-miR-4711-5p	CLIP-seq
MIRT1984399	hsa-miR-4722-5p	CLIP-seq
MIRT2219507	hsa-miR-4739	CLIP-seq
MIRT2219508	hsa-miR-4756-5p	CLIP-seq
MIRT2219509	hsa-miR-4798-3p	CLIP-seq
MIRT2219510	hsa-miR-613	CLIP-seq
MIRT1984404	hsa-miR-632	CLIP-seq
MIRT2448783	hsa-miR-1287	CLIP-seq
MIRT2448784	hsa-miR-18a	CLIP-seq
MIRT2448785	hsa-miR-18b	CLIP-seq
MIRT2448786	hsa-miR-198	CLIP-seq
MIRT2448787	hsa-miR-2054	CLIP-seq
MIRT2448788	hsa-miR-3135b	CLIP-seq
MIRT1984393	hsa-miR-455-3p	CLIP-seq
MIRT2448789	hsa-miR-4735-3p	CLIP-seq
MIRT2448790	hsa-miR-4779	CLIP-seq
MIRT959991	hsa-miR-1207-3p	CLIP-seq
MIRT959999	hsa-miR-3192	CLIP-seq
MIRT960006	hsa-miR-4300	CLIP-seq
MIRT960010	hsa-miR-4768-5p	CLIP-seq
MIRT960021	hsa-miR-920	CLIP-seq
MIRT960022	hsa-miR-942	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
NFKB1	Unknown	12746898
RELA	Unknown	12746898

Show/Hide all(25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	9234700
GO:0001824	Process	Blastocyst development	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	10821850
GO:0005515	Function	Protein binding	IPI	10391676, 12624109, 15075319, 26977885, 32911434
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	NAS	9234700
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005794	Component	Golgi apparatus	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006954	Process	Inflammatory response	IEP	14715662
GO:0030154	Process	Cell differentiation	IBA	21873635
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0030855	Process	Epithelial cell differentiation	IEA
GO:0045747	Process	Positive regulation of Notch signaling pathway	TAS
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IDA	10773884
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	9234700
GO:0060056	Process	Mammary gland involution	ISS
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
602191	3318	ENSG00000163435

Protein

UniProt ID

P78545

Protein name

ETS-related transcription factor Elf-3 (E74-like factor 3) (Epithelial-restricted with serine box) (Epithelium-restricted Ets protein ESX) (Epithelium-specific Ets transcription factor 1) (ESE-1)

Protein function

Transcriptional activator that binds and transactivates ETS sequences containing the consensus nucleotide core sequence GGA[AT]. Acts synergistically with POU2F3 to transactivate the SPRR2A promoter and with RUNX1 to transactivate the ANGPT1 pro

PDB

2E8P

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02198	SAM_PNT	48 → 132	Sterile alpha motif (SAM)/Pointed domain	Domain
PF00178	Ets	274 → 355	Ets-domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed exclusively in tissues containing a high content of terminally differentiated epithelial cells including mammary gland, colon, trachea, kidney, prostate, uterus, stomach and skin. {ECO:0000269|PubMed:9129154, ECO:0000269|PubM

Sequence

MAATCEISNIFSNYFSAMYSSEDSTLASVPPAATFGADDLVLTLSNPQMSLEGTEKASWL
GEQPQFWSKTQVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQ
LHAQLRDLTSSSSDELSWIIELLEKDGMAFQEALDPGPFDQGSPFAQELLDDGQQASPYH
PGSCGAGAPSPGSSDVSTAGTGASRSSHSSDSGGSDVDLDPTDGKLFPSDGFRDCKKGDP
KHGKRKRGRPRKLSKEYWDCLEGKKSKHAPRGTHLWEFIRDILIHPELNEGLMKWENRHE
GVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNSSG
WKEEEVLQSRN

Sequence length

371

Interactions

View interactions

	Reactome
			Pre-NOTCH Transcription and Translation

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
Papillary Renal Carcinoma	Papillary Renal Carcinoma	GWAS
Systemic lupus erythematosus	Systemic lupus erythematosus	GWAS

Show/Hide Text Mining Associations (50)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	24390348, 26804919
Adenocarcinoma of Lung	Associate	26977885
Arthritis Rheumatoid	Associate	12746898
Autism Spectrum Disorder	Associate	34946850
Breast Neoplasms	Associate	12031094, 15169914, 17172821, 17491012, 21871131, 28247944, 29187433
Carcinogenesis	Associate	17172821, 34072506, 36329620
Carcinoma Embryonal	Associate	24694612
Carcinoma Hepatocellular	Stimulate	29523781
Carcinoma Mucoepidermoid	Associate	33832503
Carcinoma Neuroendocrine	Associate	36840413
Carcinoma Non Small Cell Lung	Associate	27827952, 29208568, 38169645
Carcinoma Ovarian Epithelial	Associate	28199976
Carcinoma Pancreatic Ductal	Associate	36329620
Cartilage Diseases	Associate	29550824, 34250664
Cell Transformation Neoplastic	Associate	24694612
Collagen Diseases	Associate	34250664
Colorectal Neoplasms	Associate	19074849, 24874735, 33402466
Endotoxemia	Associate	11036073
Familial cylindromatosis	Associate	31409603
Fibrosis	Associate	34237252
Gallbladder Neoplasms	Associate	32839463
Glioma	Associate	33014189
Glycogen Storage Disease Type IV	Associate	35216615
Hydroa Vacciniforme	Associate	32682634
Hyperglycemia	Stimulate	35607962
IgA Vasculitis	Associate	12746898
Inflammation	Associate	11036073, 26185364, 29550824, 36329620
Inflammation	Stimulate	33144684
Leukemia Promyelocytic Acute	Associate	26185364
Lung Neoplasms	Associate	34830169
Lymphatic Metastasis	Associate	27827952
Neoplasm Metastasis	Stimulate	29208568
Neoplasms	Associate	12031094, 12242338, 24874735, 26804919, 26806338, 26856686, 26977885, 29208568, 30620386, 30665374, 31104013, 32839463, 33144684, 34072506, 36329620, 36840413, 38169645 View all (2 more)
Neoplasms	Inhibit	20479932, 33618713, 34562599
Neoplasms	Stimulate	27827952
Obesity	Associate	29550824
Osteoarthritis	Associate	12746898, 26603474, 29550824
Ovarian Neoplasms	Associate	28199976, 33493131, 38025760
Prostatic Neoplasms	Associate	26856686
Prostatic Neoplasms	Stimulate	35472129
Prostatitis	Associate	20479932, 35472129
Sarcoma Synovial	Associate	12414507
Seminoma	Associate	11073819
Squamous Cell Carcinoma of Head and Neck	Associate	35258410
Stomach Neoplasms	Associate	33618713, 36457025, 39350044
Thymic epithelial tumor	Associate	30832724
Ureteral Neoplasms	Associate	36818471
Urinary Bladder Neoplasms	Associate	27699256, 31104013, 31233191, 34562599
Uterine Cervical Dysplasia	Associate	36951594
Vascular System Injuries	Associate	35607962

ELF3 (E74 like ETS transcription factor 3)