Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1997
Gene name Gene Name - the full gene name approved by the HGNC.
E74 like ETS transcription factor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ELF1
Synonyms (NCBI Gene) Gene synonyms aliases
EFTUD1, RIA1
Chromosome Chromosome number
13
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
13q14.11
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes an E26 transformation-specific related transcription factor. The encoded protein is primarily expressed in lymphoid cells and acts as both an enhancer and a repressor to regulate transcription of various genes. Alternative splicing resul
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT044877 hsa-miR-194-5p CLASH 23622248
MIRT735973 hsa-miR-330-3p Luciferase reporter assay, Western blotting, RNA-seq, qRT-PCR 34201504
MIRT735976 hsa-miR-450b-5p Luciferase reporter assay, Western blotting, RNA-seq, qRT-PCR 34201504
MIRT959834 hsa-miR-1 CLIP-seq
MIRT959835 hsa-miR-186 CLIP-seq
Transcription factors
Transcription factor Regulation Reference
RB1 Unknown 7702750
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 8756667
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IDA 8756667
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
189973 3316 ENSG00000120690
Protein
UniProt ID P32519
Protein name ETS-related transcription factor Elf-1 (E74-like factor 1)
Protein function Transcription factor that activates the LYN and BLK promoters. Appears to be required for the T-cell-receptor-mediated trans activation of HIV-2 gene expression. Binds specifically to two purine-rich motifs in the HIV-2 enhancer. {ECO:0000269|Pu
PDB 8BZM
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12310 Elf-1_N 2 111 Transcription factor protein N terminal Family
PF00178 Ets 209 290 Ets-domain Domain
Tissue specificity TISSUE SPECIFICITY: In fetal tissues, it is highly expressed in heart, lung liver and kidney, and weakly expressed in brain. In adult, it is highly expressed in pancreas, spleen, thymus and peripheral blood leukocytes, expressed at moderate levels in hear
Sequence
MAAVVQQNDLVFEFASNVMEDERQLGDPAIFPAVIVEHVPGADILNSYAGLACVEEPNDM
ITESSLDVAEEEIIDDDDDDITLTVEASCHDGDETIETIEAAEALLNMDSP
GPMLDEKRI
NNNIFSSPEDDMVVAPVTHVSVTLDGIPEVMETQQVQEKYADSPGASSPEQPKRKKGRKT
KPPRPDSPATTPNISVKKKNKDGKGNTIYLWEFLLALLQDKATCPKYIKWTQREKGIFKL
VDSKAVSRLWGKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQFK
EMPKDLIYIN
DEDPSSSIESSDPSLSSSATSNRNQTSRSRVSSSPGVKGGATTVLKPGNSKAAKPKDPVE
VAQPSEVLRTVQPTQSPYPTQLFRTVHVVQPVQAVPEGEAARTSTMQDETLNSSVQSIRT
IQAPTQVPVVVSPRNQQLHTVTLQTVPLTTVIASTDPSAGTGSQKFILQAIPSSQPMTVL
KENVMLQSQKAGSPPSIVLGPAQVQQVLTSNVQTICNGTVSVASSPSFSATAPVVTFSPR
SSQLVAHPPGTVITSVIKTQETKTLTQEVEKKESEDHLKENTEKTEQQPQPYVMVVSSSN
GFTSQVAMKQNELLEPNSF
Sequence length 619
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    RUNX1 regulates transcription of genes involved in BCR signaling
RUNX1 regulates transcription of genes involved in interleukin signaling
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Crohn disease Crohn Disease 23266558 ClinVar
Systemic lupus erythematosus Systemic lupus erythematosus GWAS
Crohn Disease Crohn Disease GWAS
Cervical Cancer Cervical Cancer Our screens identified 10 miRNAs that enhance fitness of HeLa cells and have been reported to be up-regulated in cervical cancer (Table2). GWAS, CBGDA
Associations from Text Mining
Disease Name Relationship Type References
Aortic Aneurysm Abdominal Associate 25993293
Atherosclerosis Associate 36720950
Atrial Fibrillation Associate 36226239
Breast Neoplasms Associate 7914192
Carcinoma Non Small Cell Lung Associate 20346215, 32271431
Carcinoma Ovarian Epithelial Associate 34794761
Glioblastoma Associate 34395626
Granulomatous Disease Chronic Associate 10233904
Hereditary Breast and Ovarian Cancer Syndrome Associate 18314487
Hereditary leiomyomatosis and renal cell cancer Inhibit 30681722