Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1995
Gene name Gene Name - the full gene name approved by the HGNC.
ELAV like RNA binding protein 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ELAVL3
Synonyms (NCBI Gene) Gene synonyms aliases
HUC, HUCL, PLE21
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.2
Summary Summary of gene provided in NCBI Entrez Gene.
A member of the ELAVL protein family, ELAV-like 3 is a neural-specific RNA-binding protein which contains three RNP-type RNA recognition motifs. The observation that ELAVL3 is one of several Hu antigens (neuronal-specific RNA-binding proteins) recognized
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT028772 hsa-miR-26b-5p Microarray 19088304
MIRT624046 hsa-miR-5088-3p HITS-CLIP 23824327
MIRT624045 hsa-miR-7110-3p HITS-CLIP 23824327
MIRT624044 hsa-miR-6817-3p HITS-CLIP 23824327
MIRT624042 hsa-miR-130b-5p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding IEA
GO:0003730 Function MRNA 3'-UTR binding IEA
GO:0005515 Function Protein binding IPI 36950384, 37207277
GO:0007399 Process Nervous system development IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603458 3314 ENSG00000196361
Protein
UniProt ID Q14576
Protein name ELAV-like protein 3 (Hu-antigen C) (HuC) (Paraneoplastic cerebellar degeneration-associated antigen) (Paraneoplastic limbic encephalitis antigen 21)
Protein function RNA-binding protein that binds to AU-rich element (ARE) sequences of target mRNAs, including VEGF mRNA (PubMed:10710437). May also bind poly-A tracts via RRM 3 (By similarity). May be involved in neuronal differentiation and maintenance (By simi
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 41 111 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
PF00076 RRM_1 127 195 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
PF00076 RRM_1 286 356 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Tissue specificity TISSUE SPECIFICITY: Brain specific.
Sequence
MVTQILGAMESQVGGGPAGPALPNGPLLGTNGATDDSKTNLIVNYLPQNMTQDEFKSLFG
SIGDIESCKLVRDKITGQSLGYGFVNYSDPNDADKAINTLNGLKLQTKTIK
VSYARPSSA
SIRDANLYVSGLPKTMSQKEMEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAE
EAIKGLNGQKPLGAA
EPITVKFANNPSQKTGQALLTHLYQSSARRYAGPLHHQTQRFRLD
NLLNMAYGVKSPLSLIARFSPIAIDGMSGLAGVGLSGGAAGAGWCIFVYNLSPEADESVL
WQLFGPFGAVTNVKVIRDFTTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGERVLQ
VSFK
TSKQHKA
Sequence length 367
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
Oligodendroglioma Oligodendroglioma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Amyotrophic lateral sclerosis 1 Associate 34618203
Autistic Disorder Associate 37076741
Developmental Disabilities Associate 37501076
Drug Related Side Effects and Adverse Reactions Associate 34618203
Ischemic Stroke Associate 32815572
Liver Neoplasms Associate 34618203
Lymphoma Non Hodgkin Associate 34214505
Microcephaly Associate 37501076
Neoplasms Associate 23324039
Peripheral Nervous System Diseases Associate 9288629