Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1975
Gene name Gene Name - the full gene name approved by the HGNC.
Eukaryotic translation initiation factor 4B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
EIF4B
Synonyms (NCBI Gene) Gene synonyms aliases
EIF-4B, PRO1843
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q13.13
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016421 hsa-miR-193b-3p Proteomics 21512034
MIRT031710 hsa-miR-16-5p Proteomics 18668040
MIRT031710 hsa-miR-16-5p CLASH 23622248
MIRT050302 hsa-miR-25-3p CLASH 23622248
MIRT049349 hsa-miR-92a-3p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001731 Process Formation of translation preinitiation complex IBA 21873635
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0003743 Function Translation initiation factor activity IEA
GO:0005515 Function Protein binding IPI 21044950, 21887822, 32814053
GO:0005829 Component Cytosol IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603928 3285 ENSG00000063046
Protein
UniProt ID P23588
Protein name Eukaryotic translation initiation factor 4B (eIF-4B)
Protein function Required for the binding of mRNA to ribosomes. Functions in close association with EIF4-F and EIF4-A. Binds near the 5'-terminal cap of mRNA in presence of EIF-4F and ATP. Promotes the ATPase activity and the ATP-dependent RNA unwinding activity
PDB 1WI8 , 2J76 , 6FEC
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 98 167 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Sequence
MAASAKKKNKKGKTISLTDFLAEDGGTGGGSTYVSKPVSWADETDDLEGDVSTTWHSNDD
DVYRAPPIDRSILPTAPRAAREPNIDRSRLPKSPPYTAFLGNLPYDVTEESIKEFFRGLN
ISAVRLPREPSNPERLKGFGYAEFEDLDSLLSALSLNEESLGNRRIR
VDVADQAQDKDRD
DRSFGRDRNRDSDKTDTDWRARPATDSFDDYPPRRGDDSFGDKYRDRYDSDRYRDGYRDG
YRDGPRRDMDRYGGRDRYDDRGSRDYDRGYDSRIGSGRRAFGSGYRRDDDYRGGGDRYED
RYDRRDDRSWSSRDDYSRDDYRRDDRGPPQRPKLNLKPRSTPKEDDSSASTSQSTRAASI
FGGAKPVDTAAREREVEERLQKEQEKLQRQLDEPKLERRPRERHPSWRSEETQERERSRT
GSESSQTGTSTTSSRNARRRESEKSLENETLNKEEDCHSPTSKPPKPDQPLKVMPAPPPK
ENAWVKRSSNPPARSQSSDTEQQSPTSGGGKVAPAQPSEEGPGRKDENKVDGMNAPKGQT
GNSSRGPGDGGNRDHWKESDRKDGKKDQDSRSAPEPKKPEENPASKFSSASKYAALSVDG
EDENEGEDYAE
Sequence length 611
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  mTOR signaling pathway
PI3K-Akt signaling pathway
Proteoglycans in cancer
  L13a-mediated translational silencing of Ceruloplasmin expression
mTORC1-mediated signalling
Deadenylation of mRNA
Translation initiation complex formation
Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S
Ribosomal scanning and start codon recognition
GTP hydrolysis and joining of the 60S ribosomal subunit
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Mental depression Unipolar Depression, Major Depressive Disorder 21635931 ClinVar
Cleft Lip With Or Without Cleft Palate Cleft Lip With Or Without Cleft Palate GWAS
Prostate cancer Prostate cancer Together, these results show that PRRX2 is an oncogene and might play a role in the aggressiveness of PC within the DNPC population. GWAS, CBGDA
Associations from Text Mining
Disease Name Relationship Type References
Alzheimer Disease Associate 15985314
Breast Neoplasms Associate 25611378, 27926932
Carcinoma Hepatocellular Associate 12521301
Carcinoma Non Small Cell Lung Associate 27501049
Carcinoma Squamous Cell Associate 24205356
Cholangiocarcinoma Associate 37781039
Lymphoma Large B Cell Diffuse Associate 24135829
Neoplasms Associate 20145189, 22546478
Nerve Degeneration Associate 36624125
Parkinson Disease Associate 15985314