MLKL (mixed lineage kinase domain like pseudokinase)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 197259
Gene name Mixed lineage kinase domain like pseudokinase
Gene symbol MLKL
Synonyms (NCBI Gene)
hMLKL
Chromosome 16
Chromosome location 16q23.1
Summary This gene belongs to the protein kinase superfamily. The encoded protein contains a protein kinase-like domain; however, is thought to be inactive because it lacks several residues required for activity. This protein plays a critical role in tumor necrosi
miRNA miRNA information provided by mirtarbase database.
12
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (12)
miRTarBase ID miRNA Experiments Reference
MIRT1151088 hsa-miR-1587 CLIP-seq
MIRT1151089 hsa-miR-3147 CLIP-seq
MIRT1151090 hsa-miR-3201 CLIP-seq
MIRT1151091 hsa-miR-4422 CLIP-seq
MIRT1151092 hsa-miR-4496 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
33
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (33)
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0004672 Function Protein kinase activity ISS
GO:0004674 Function Protein serine/threonine kinase activity IBA
GO:0005515 Function Protein binding IPI 22265413, 22265414, 29883609, 32296183
GO:0005524 Function ATP binding IDA 24219132
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
615153 26617 ENSG00000168404
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NB16
Protein name Mixed lineage kinase domain-like protein (hMLKL)
Protein function Pseudokinase that plays a key role in TNF-induced necroptosis, a programmed cell death process (PubMed:22265413, PubMed:22265414, PubMed:22421439, PubMed:24316671). Does not have protein kinase activity (PubMed:22265413, PubMed:22265414, PubMed:
PDB 2MSV , 4M67 , 4MWI , 5KNJ , 5KO1 , 6BWK , 6D74 , 6LK5 , 6LK6 , 6O5Z , 6UX8 , 6ZLE , 6ZPR , 6ZVO , 6ZZ1 , 7JW7 , 7JXU , 7MON , 7NM2 , 7NM4 , 7NM5 , 8SLZ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07714 PK_Tyr_Ser-Thr 209 → 466 Protein tyrosine and serine/threonine kinase Domain
Sequence 
MENLKHIITLGQVIHKRCEEMKYCKKQCRRLGHRVLGLIKPLEMLQDQGKRSVPSEKLTT
AMNRFKAALEEANGEIEKFSNRSNICRFLTASQDKILFKDVNRKLSDVWKELSLLLQVEQ
RMPVSPISQGASWAQEDQQDADEDRRAFQMLRRDNEKIEASLRRLEINMKEIKETLRQYL
PPKCMQEIPQEQIKEIKKEQLSGSPWILLRENEVSTLYKGEYHRAPVAIKVFKKLQAGSI
AIVRQTFNKEIKTMKKFESPNILRIFGICIDETVTPPQFSIVMEYCELGTLRELLDREKD
LTLGKRMVLVLGAARGLYRLHHSEAPELHGKIRSSNFLVTQGYQVKLAGFELRKTQTSMS
LGTTREKTDRVKSTAYLSPQELEDVFYQYDVKSEIYSFGIVLWEIATGDIPFQGCNSEKI
RKLVAVKRQQEPLGEDCPSELREIIDECRAHDPSVRPSVDEILKKLSTFSK
Sequence length 471
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  Necroptosis
Cytosolic DNA-sensing pathway
TNF signaling pathway
Salmonella infection 		  TRP channels
RIPK1-mediated regulated necrosis
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
7
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (6)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Biotinidase deficiency Conflicting classifications of pathogenicity rs1186283623 RCV002280002
Chronic multifocal osteomyelitis association rs34515646, rs35589326 RCV001250662
RCV001250661
Clear cell carcinoma of kidney Benign rs33987771 RCV005908704
Maturity-onset diabetes of the young - rs375490660 RCV001533784
Show/Hide Text Mining Associations (61)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Acute Kidney Injury Associate 32755955
Adenocarcinoma Associate 37519036
Alzheimer Disease Associate 34625123
Aortic Dissection Associate 35480868
Atherosclerosis Associate 32788571, 34217157
Burkitt Lymphoma Associate 33971465
Carcinoma Hepatocellular Associate 35264437
Carcinoma Non Small Cell Lung Associate 37519036, 38126996, 39285232
Carcinoma Renal Cell Associate 33786632
Carcinoma Squamous Cell Associate 25910754