MLKL (mixed lineage kinase domain like pseudokinase)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
197259
Gene name Gene Name - the full gene name approved by the HGNC.
Mixed lineage kinase domain like pseudokinase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MLKL
Synonyms (NCBI Gene) Gene synonyms aliases
hMLKL
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16q23.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene belongs to the protein kinase superfamily. The encoded protein contains a protein kinase-like domain; however, is thought to be inactive because it lacks several residues required for activity. This protein plays a critical role in tumor necrosi
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(12)
miRTarBase ID miRNA Experiments Reference
MIRT1151088 hsa-miR-1587 CLIP-seq
MIRT1151089 hsa-miR-3147 CLIP-seq
MIRT1151090 hsa-miR-3201 CLIP-seq
MIRT1151091 hsa-miR-4422 CLIP-seq
MIRT1151092 hsa-miR-4496 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(23)
GO ID Ontology Definition Evidence Reference
GO:0004672 Function Protein kinase activity IBA 21873635
GO:0004672 Function Protein kinase activity ISS
GO:0004706 Function JUN kinase kinase kinase activity IBA 21873635
GO:0005515 Function Protein binding IPI 22265413, 22265414, 29883609
GO:0005524 Function ATP binding IDA 24219132
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
615153 26617 ENSG00000168404
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q8NB16
Protein name Mixed lineage kinase domain-like protein (hMLKL)
Protein function Pseudokinase that plays a key role in TNF-induced necroptosis, a programmed cell death process (PubMed:22265413, PubMed:22265414, PubMed:22421439, PubMed:24316671). Does not have protein kinase activity (PubMed:22265413, PubMed:22265414, PubMed:
PDB 2MSV , 4M67 , 4MWI , 5KNJ , 5KO1 , 6BWK , 6D74 , 6LK5 , 6LK6 , 6O5Z , 6UX8 , 6ZLE , 6ZPR , 6ZVO , 6ZZ1 , 7JW7 , 7JXU , 7MON , 7NM2 , 7NM4 , 7NM5 , 8SLZ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07714 PK_Tyr_Ser-Thr 209 → 466 Protein tyrosine and serine/threonine kinase Domain
Sequence 
MENLKHIITLGQVIHKRCEEMKYCKKQCRRLGHRVLGLIKPLEMLQDQGKRSVPSEKLTT
AMNRFKAALEEANGEIEKFSNRSNICRFLTASQDKILFKDVNRKLSDVWKELSLLLQVEQ
RMPVSPISQGASWAQEDQQDADEDRRAFQMLRRDNEKIEASLRRLEINMKEIKETLRQYL
PPKCMQEIPQEQIKEIKKEQLSGSPWILLRENEVSTLYKGEYHRAPVAIKVFKKLQAGSI
AIVRQTFNKEIKTMKKFESPNILRIFGICIDETVTPPQFSIVMEYCELGTLRELLDREKD
LTLGKRMVLVLGAARGLYRLHHSEAPELHGKIRSSNFLVTQGYQVKLAGFELRKTQTSMS
LGTTREKTDRVKSTAYLSPQELEDVFYQYDVKSEIYSFGIVLWEIATGDIPFQGCNSEKI
RKLVAVKRQQEPLGEDCPSELREIIDECRAHDPSVRPSVDEILKKLSTFSK
Sequence length 471
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Necroptosis
Cytosolic DNA-sensing pathway
TNF signaling pathway
Salmonella infection 		  TRP channels
RIPK1-mediated regulated necrosis
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Gastric cancer Gastric Adenocarcinoma rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802
View all (244 more)
Show/Hide Text Mining Associations (61)
Associations from Text Mining
Disease Name Relationship Type References
Acute Kidney Injury Associate 32755955
Adenocarcinoma Associate 37519036
Alzheimer Disease Associate 34625123
Aortic Dissection Associate 35480868
Atherosclerosis Associate 32788571, 34217157
Burkitt Lymphoma Associate 33971465
Carcinoma Hepatocellular Associate 35264437
Carcinoma Non Small Cell Lung Associate 37519036, 38126996, 39285232
Carcinoma Renal Cell Associate 33786632
Carcinoma Squamous Cell Associate 25910754