Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
197135
Gene name Gene Name - the full gene name approved by the HGNC.
PAT1 homolog 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PATL2
Synonyms (NCBI Gene) Gene synonyms aliases
OOMD4, OZEMA4, Pat1a, hPat1a
Chromosome Chromosome number
15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
15q21.1
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs548527219 G>A Likely-pathogenic Stop gained, coding sequence variant, 5 prime UTR variant, intron variant
rs751701388 TGGAACAGGAGGG>- Pathogenic Intron variant, splice acceptor variant
rs752734259 A>G,T Pathogenic Stop gained, coding sequence variant, intron variant, 5 prime UTR variant, synonymous variant
rs1156737044 A>C Likely-pathogenic Intron variant, 5 prime UTR variant, coding sequence variant, missense variant
rs1351320025 G>A Likely-pathogenic Stop gained, coding sequence variant
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000290 Process Deadenylation-dependent decapping of nuclear-transcribed mRNA IBA
GO:0000290 Process Deadenylation-dependent decapping of nuclear-transcribed mRNA IEA
GO:0000932 Component P-body IBA
GO:0000932 Component P-body IEA
GO:0003723 Function RNA binding IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
614661 33630 ENSG00000229474
Protein
UniProt ID C9JE40
Protein name Protein PAT1 homolog 2 (PAT1-like protein 2) (Protein PAT1 homolog a) (Pat1a) (hPat1a)
Protein function RNA-binding protein that acts as a translational repressor.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09770 PAT1 252 491 Topoisomerase II-associated protein PAT1 Family
Tissue specificity TISSUE SPECIFICITY: Highly expressed in oocytes. {ECO:0000269|PubMed:28965849}.
Sequence
MNCLEGPGKTCGPLASEEELVSACQLEKEEENEGEEEEEEEDEEDLDPDLDPDLEEEEND
LGDPAVLGAVHNTQRALLSSPGVKAPGMLGMSLASLHFLWQTLDYLSPIPFWPTFPSTSS
PAQHFGPRLPSPDPTLFCSLLTSWPPRFSHLTQLHPRHQRILQQQQHSQTPSPPAKKPWS
QQPDPYANLMTRKEKDWVIKVQMVQLQSAKPRLDDYYYQEYYQKLEKKQADEELLGRRNR
VESLKLVTPYIPKAEAYESVVRIEGSLGQVAVSTCFSPRRAIDAVPHGTQEQDIEAASSQ
RLRVLYRIEKMFLQLLEIEEGWKYRPPPPCFSEQQSNQVEKLFQTLKTQEQNNLEEAADG
FLQVLSVRKGKALVARLLPFLPQDQAVTILLAITHHLPLLVRRDVADQALQMLFKPLGKC
ISHLTLHELLQGLQGLTLLPPGSSERPVTVVLQNQFGISLLYALLSHGEQLVSLHSSLEE
PNSDHTAWTDM
VVLIAWEIAQMPTASLAEPLAFPSNLLPLFCHHVDKQLVQQLEARMEFA
WIY
Sequence length 543
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Oocyte Maturation Defect oocyte maturation defect 4, oocyte maturation defect 2 rs1351320025, rs752734259, rs751701388, rs1555385717, rs1361024832, rs1156737044, rs548527219 N/A
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Embryonal Associate 35091966
Infertility Associate 28965844, 35091966
Infertility Female Associate 28965849, 32048119, 35091966, 38536595
Neoplasms Germ Cell and Embryonal Associate 38536595
Polycystic Ovary Syndrome Associate 34008465
Renal Insufficiency Associate 38536595
Tertiary Lymphoid Structures Associate 34008465