Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1965
Gene name Gene Name - the full gene name approved by the HGNC.
Eukaryotic translation initiation factor 2 subunit alpha
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
EIF2S1
Synonyms (NCBI Gene) Gene synonyms aliases
EIF-2, EIF-2A, EIF-2alpha, EIF2, EIF2A
Chromosome Chromosome number
14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
14q23.3
Summary Summary of gene provided in NCBI Entrez Gene.
The translation initiation factor EIF2 catalyzes the first regulated step of protein synthesis initiation, promoting the binding of the initiator tRNA to 40S ribosomal subunits. Binding occurs as a ternary complex of methionyl-tRNA, EIF2, and GTP. EIF2 is
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004813 hsa-miR-21-5p Quantitative proteomic approach 19253296
MIRT019778 hsa-miR-375 Microarray 20215506
MIRT026383 hsa-miR-192-5p Sequencing 20371350
MIRT046815 hsa-miR-222-3p CLASH 23622248
MIRT070854 hsa-miR-520f-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000423 Process Mitophagy IDA 38340717
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0003723 Function RNA binding IEA
GO:0003743 Function Translation initiation factor activity IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603907 3265 ENSG00000134001
Protein
UniProt ID P05198
Protein name Eukaryotic translation initiation factor 2 subunit 1 (Eukaryotic translation initiation factor 2 subunit alpha) (eIF-2-alpha) (eIF-2A) (eIF-2alpha) (eIF2-alpha)
Protein function Member of the eIF2 complex that functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA (PubMed:16289705, PubMed:38340717). This complex binds to a 40S ribosomal subunit, followed by mRNA bindin
PDB 1KL9 , 1Q8K , 6K71 , 6K72 , 6O81 , 6O85 , 6O9Z , 6YBV , 6ZMW , 6ZP4 , 7A09 , 7D43 , 7D44 , 7D45 , 7F66 , 7F67 , 7NZM , 7QP6 , 7QP7 , 7SYR , 7SYS , 8OZ0 , 8PJ1 , 8PJ2 , 8PJ3 , 8PJ4 , 8PPL , 8QZZ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00575 S1 14 88 S1 RNA binding domain Domain
PF07541 EIF_2_alpha 130 244 Eukaryotic translation initiation factor 2 alpha subunit Family
Sequence
MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSIN
KLIRIGRNECVVVIRVDKEKGYIDLSKR
RVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
YTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNI
NRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNCSTENMPIKINLIAPPRYVMTTT
TLER
TEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQMERLERENAEV
DGDDDAEEMEAKAED
Sequence length 315
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Mitophagy - animal
Autophagy - animal
Protein processing in endoplasmic reticulum
Apoptosis
Non-alcoholic fatty liver disease
Alzheimer disease
Parkinson disease
Amyotrophic lateral sclerosis
Prion disease
Pathways of neurodegeneration - multiple diseases
Hepatitis C
Measles
Influenza A
Herpes simplex virus 1 infection
Lipid and atherosclerosis
  L13a-mediated translational silencing of Ceruloplasmin expression
PERK regulates gene expression
ABC-family proteins mediated transport
Translation initiation complex formation
Formation of the ternary complex, and subsequently, the 43S complex
Ribosomal scanning and start codon recognition
GTP hydrolysis and joining of the 60S ribosomal subunit
Recycling of eIF2:GDP
<