PLPP4 (phospholipid phosphatase 4)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID 196051
Gene name Phospholipid phosphatase 4
Gene symbol PLPP4
Synonyms (NCBI Gene)
DPPL2PPAPDC1PPAPDC1A
Chromosome 10
Chromosome location 10q26.12
miRNA miRNA information provided by mirtarbase database.
36
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all (36)
miRTarBase ID miRNA Experiments Reference
MIRT625517 hsa-miR-508-5p HITS-CLIP 23824327
MIRT625516 hsa-miR-148a-3p HITS-CLIP 23824327
MIRT625515 hsa-miR-148b-3p HITS-CLIP 23824327
MIRT625514 hsa-miR-152-3p HITS-CLIP 23824327
MIRT625513 hsa-miR-1273g-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
20
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all (20)
GO ID Ontology Definition Evidence Reference
GO:0000810 Function Diacylglycerol diphosphate phosphatase activity IDA 17590538
GO:0000810 Function Diacylglycerol diphosphate phosphatase activity IEA
GO:0001835 Process Blastocyst hatching IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005886 Component Plasma membrane TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5VZY2
Protein name Phospholipid phosphatase 4 (EC 3.1.3.4) (EC 3.6.1.75) (Phosphatidic acid phosphatase type 2 domain-containing protein 1A)
Protein function Magnesium-independent phospholipid phosphatase with broad substrate specificity (PubMed:17590538). Preferentially catalyzes the conversion of diacylglycerol pyrophosphate into phosphatidate but can also act on phosphatidate and lysophosphatidate
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01569 PAP2 83 → 229 PAP2 superfamily Family
Tissue specificity TISSUE SPECIFICITY: Expressed mainly to the brain, kidney and testis, and to a lesser extent the bone marrow, thymus, prostate, liver and uterus. {ECO:0000269|PubMed:17590538}.
Sequence 
MRELAIEIGVRALLFGVFVFTEFLDPFQRVIQPEEIWLYKNPLVQSDNIPTRLMFAISFL
TPLAVICVVKIIRRTDKTEIKEAFLAVSLALALNGVCTNTIKLIVGRPRPDFFYRCFPDG
VMNSEMHCTGDPDLVSEGRKSFPSIHSSFAFSGLGFTTFYLAGKLHCFTESGRGKSWRLC
AAILPLYCAMMIALSRMCDYKHHWQDSFVGGVIGLIFAYICYRQHYPPLANTACHKPYVS
LRVPASLKKEERPTADSAPSLPLEGITEGPV
Sequence length 271
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways
  KEGG  Reactome
  Glycerolipid metabolism
Glycerophospholipid metabolism 		  Role of phospholipids in phagocytosis