PLPP4 (phospholipid phosphatase 4)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
196051
Gene name Gene Name - the full gene name approved by the HGNC.
Phospholipid phosphatase 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PLPP4
Synonyms (NCBI Gene) Gene synonyms aliases
DPPL2, PPAPDC1, PPAPDC1A
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q26.12
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(36)
miRTarBase ID miRNA Experiments Reference
MIRT625517 hsa-miR-508-5p HITS-CLIP 23824327
MIRT625516 hsa-miR-148a-3p HITS-CLIP 23824327
MIRT625515 hsa-miR-148b-3p HITS-CLIP 23824327
MIRT625514 hsa-miR-152-3p HITS-CLIP 23824327
MIRT625513 hsa-miR-1273g-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(13)
GO ID Ontology Definition Evidence Reference
GO:0000810 Function Diacylglycerol diphosphate phosphatase activity IDA 17590538
GO:0001835 Process Blastocyst hatching IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005886 Component Plasma membrane TAS
GO:0006644 Process Phospholipid metabolic process IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q5VZY2
Protein name Phospholipid phosphatase 4 (EC 3.1.3.4) (EC 3.6.1.75) (Phosphatidic acid phosphatase type 2 domain-containing protein 1A)
Protein function Magnesium-independent phospholipid phosphatase with broad substrate specificity (PubMed:17590538). Preferentially catalyzes the conversion of diacylglycerol pyrophosphate into phosphatidate but can also act on phosphatidate and lysophosphatidate
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01569 PAP2 83 → 229 PAP2 superfamily Family
Tissue specificity TISSUE SPECIFICITY: Expressed mainly to the brain, kidney and testis, and to a lesser extent the bone marrow, thymus, prostate, liver and uterus. {ECO:0000269|PubMed:17590538}.
Sequence 
MRELAIEIGVRALLFGVFVFTEFLDPFQRVIQPEEIWLYKNPLVQSDNIPTRLMFAISFL
TPLAVICVVKIIRRTDKTEIKEAFLAVSLALALNGVCTNTIKLIVGRPRPDFFYRCFPDG
VMNSEMHCTGDPDLVSEGRKSFPSIHSSFAFSGLGFTTFYLAGKLHCFTESGRGKSWRLC
AAILPLYCAMMIALSRMCDYKHHWQDSFVGGVIGLIFAYICYRQHYPPLANTACHKPYVS
LRVPASLKKEERPTADSAPSLPLEGITEGPV
Sequence length 271
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Glycerolipid metabolism
Glycerophospholipid metabolism 		  Role of phospholipids in phagocytosis
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (2)
Causal
Disease term Disease name dbSNP ID References
Alzheimer disease Alzheimer`s Disease rs63750215, rs28936379, rs63749851, rs63749884, rs28936380, rs63750048, rs63750579, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039
View all (65 more)		 23535033
Prostate cancer Prostate carcinoma rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582 31095341
Show/Hide Text Mining Associations (10)
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Stimulate 28851360
Adenocarcinoma of Lung Stimulate 28851360
Breast Neoplasms Associate 25201346
Carcinogenesis Stimulate 28851360
Carcinoma Squamous Cell Stimulate 28851360
HIV Infections Associate 29206233
Lung Neoplasms Associate 28851360
Neoplasms Associate 28851360
Parkinson Disease Associate 34776419
Stomach Neoplasms Associate 30361512