Gene Gene information from NCBI Gene database.
Entrez ID 1948
Gene name Ephrin B2
Gene symbol EFNB2
Synonyms (NCBI Gene)
EPLG5HTKLHtk-LLERK5ephrin-B2
Chromosome 13
Chromosome location 13q33.3
Summary This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system a
miRNA miRNA information provided by mirtarbase database.
349
miRTarBase ID miRNA Experiments Reference
MIRT006337 hsa-miR-20b-5p Luciferase reporter assay 22438230
MIRT006337 hsa-miR-20b-5p Luciferase reporter assay 22438230
MIRT006337 hsa-miR-20b-5p Luciferase reporter assay 22438230
MIRT007101 hsa-miR-204-5p Luciferase reporter assayqRT-PCRWestern blot 23204229
MIRT007101 hsa-miR-204-5p Luciferase reporter assayqRT-PCRWestern blot 23204229
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
59
GO ID Ontology Definition Evidence Reference
GO:0001525 Process Angiogenesis IDA 12734395
GO:0001525 Process Angiogenesis IDA 12734395, 22555806
GO:0001525 Process Angiogenesis IEA
GO:0001525 Process Angiogenesis IMP 28687708, 30578106
GO:0001618 Function Virus receptor activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
600527 3227 ENSG00000125266
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P52799
Protein name Ephrin-B2 (EPH-related receptor tyrosine kinase ligand 5) (LERK-5) (HTK ligand) (HTK-L)
Protein function Cell surface transmembrane ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing o
PDB 2HLE , 2I85 , 2VSK , 2VSM , 2WO2 , 3GXU , 4UF7 , 6P7Y , 6PDL
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00812 Ephrin 29 164 Ephrin Domain
Tissue specificity TISSUE SPECIFICITY: Lung and kidney.
Sequence
MAVRRDSVWKYCWGVLMVLCRTAISKSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDI
ICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPN
LWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKV
GQDASSAGSTRNKDPT
RRPELEAGTNGRSSTTSPFVKPNPGSSTDGNSAGHSGNNILGSEVALFAGIASGCIIFIV
IIITLVVLLLKYRRRHRKHSPQHTTTLSLSTLATPKRSGNNNGSEPSDIIIPLRTADSVF
CPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV
Sequence length 333
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Axon guidance   EPH-Ephrin signaling
EPHB-mediated forward signaling
Ephrin signaling
EPH-ephrin mediated repulsion of cells
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
4
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
EFNB2-related disorder Likely benign rs144052492, rs958782701, rs141519659, rs553183986 RCV003964641
RCV003981685
RCV003967287
RCV003954343
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
13q deletion syndrome Associate 28393221
Adenocarcinoma Associate 32362422
Adenocarcinoma of Lung Associate 30106131, 33021972, 39273449
Asthma Associate 28599074
Atherosclerosis Associate 21672356
Bone Diseases Associate 19664212
Breast Neoplasms Associate 23981902, 31638179
Calcinosis Cutis Associate 32362422
Capillary Malformation Arteriovenous Malformation Associate 32286515
Carcinogenesis Associate 24771266