Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1948
Gene name Gene Name - the full gene name approved by the HGNC.
Ephrin B2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
EFNB2
Synonyms (NCBI Gene) Gene synonyms aliases
EPLG5, HTKL, Htk-L, LERK5, ephrin-B2
Chromosome Chromosome number
13
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
13q33.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system a
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT006337 hsa-miR-20b-5p Luciferase reporter assay 22438230
MIRT006337 hsa-miR-20b-5p Luciferase reporter assay 22438230
MIRT006337 hsa-miR-20b-5p Luciferase reporter assay 22438230
MIRT007101 hsa-miR-204-5p Luciferase reporter assay, qRT-PCR, Western blot 23204229
MIRT007101 hsa-miR-204-5p Luciferase reporter assay, qRT-PCR, Western blot 23204229
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001618 Function Virus receptor activity IEA
GO:0002042 Process Cell migration involved in sprouting angiogenesis IDA 12734395
GO:0005515 Function Protein binding IPI 12606549, 15764601, 18488039, 19836338, 26481148, 28514442, 28904190, 32296183
GO:0005886 Component Plasma membrane IBA 21873635
GO:0005886 Component Plasma membrane IDA 17251577, 28931592
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600527 3227 ENSG00000125266
Protein
UniProt ID P52799
Protein name Ephrin-B2 (EPH-related receptor tyrosine kinase ligand 5) (LERK-5) (HTK ligand) (HTK-L)
Protein function Cell surface transmembrane ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing o
PDB 2HLE , 2I85 , 2VSK , 2VSM , 2WO2 , 3GXU , 4UF7 , 6P7Y , 6PDL
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00812 Ephrin 29 164 Ephrin Domain
Tissue specificity TISSUE SPECIFICITY: Lung and kidney.
Sequence
MAVRRDSVWKYCWGVLMVLCRTAISKSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDI
ICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPN
LWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKV
GQDASSAGSTRNKDPT
RRPELEAGTNGRSSTTSPFVKPNPGSSTDGNSAGHSGNNILGSEVALFAGIASGCIIFIV
IIITLVVLLLKYRRRHRKHSPQHTTTLSLSTLATPKRSGNNNGSEPSDIIIPLRTADSVF
CPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV
Sequence length 333
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Axon guidance   EPH-Ephrin signaling
EPHB-mediated forward signaling
Ephrin signaling
EPH-ephrin mediated repulsion of cells
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Lung cancer Malignant neoplasm of lung rs121913530, rs121913529, rs878855122, rs1057519784, rs770315135 27935865
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)
20483485
Unknown
Disease term Disease name Evidence References Source
Pulmonary hypoplasia Primary pulmonary hypoplasia 30106123 ClinVar
Associations from Text Mining
Disease Name Relationship Type References
13q deletion syndrome Associate 28393221
Adenocarcinoma Associate 32362422
Adenocarcinoma of Lung Associate 30106131, 33021972, 39273449
Asthma Associate 28599074
Atherosclerosis Associate 21672356
Bone Diseases Associate 19664212
Breast Neoplasms Associate 23981902, 31638179
Calcinosis Cutis Associate 32362422
Capillary Malformation Arteriovenous Malformation Associate 32286515
Carcinogenesis Associate 24771266