Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1947
Gene name Gene Name - the full gene name approved by the HGNC.
Ephrin B1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
EFNB1
Synonyms (NCBI Gene) Gene synonyms aliases
CFND, CFNS, EFB1, EFL3, EPLG2, Elk-L, LERK2
Disease Acronyms (UniProt) Disease acronyms from UniProt database
CFNS
Chromosome Chromosome number
X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
Xq13.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a type I membrane protein and a ligand of Eph-related receptor tyrosine kinases. It may play a role in cell adhesion and function in the development or maintenance of the nervous system. [provided by RefSeq, Jul 2008]
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs28935170 G>T Pathogenic Coding sequence variant, missense variant
rs28936069 G>A Pathogenic Coding sequence variant, missense variant
rs28936070 G>T Pathogenic Coding sequence variant, missense variant
rs28936071 A>C,G Pathogenic Coding sequence variant, missense variant
rs104894796 C>T Pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT000478 hsa-miR-124-3p qRT-PCR, Luciferase reporter assay, Western blot 20308325
MIRT025289 hsa-miR-34a-5p Proteomics 21566225
MIRT025289 hsa-miR-34a-5p Proteomics 21566225
MIRT025289 hsa-miR-34a-5p Proteomics 21566225
MIRT025289 hsa-miR-34a-5p Proteomics 21566225
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001755 Process Neural crest cell migration IEA
GO:0005515 Function Protein binding IPI 9883737, 22279592, 32296183
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IEA
GO:0005886 Component Plasma membrane IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
300035 3226 ENSG00000090776
Protein
UniProt ID P98172
Protein name Ephrin-B1 (EFL-3) (ELK ligand) (ELK-L) (EPH-related receptor tyrosine kinase ligand 2) (LERK-2) [Cleaved into: Ephrin-B1 C-terminal fragment (Ephrin-B1 CTF); Ephrin-B1 intracellular domain (Ephrin-B1 ICD)]
Protein function Cell surface transmembrane ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development (PubMed:7973638, PubMed:8070404). Binding to
PDB 6THG
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00812 Ephrin 30 164 Ephrin Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed (PubMed:7973638, PubMed:8070404). Detected in both neuronal and non-neuronal tissues (PubMed:7973638, PubMed:8070404). Seems to have particularly strong expression in retina, sciatic nerve, heart and spinal cord (PubMe
Sequence
MARPGQRWLGKWLVAMVVWALCRLATPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKL
DIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPN
YMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKV
GQDPNAVTPEQLTTSR
PSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDGFFNSKVAL
FAAVGAGCVIFLLIIIFLTVLLLKLRKRHRKHTQQRAAALSLSTLASPKGGSGTAGTEPS
DIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV
Sequence length 346
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Axon guidance   EPH-Ephrin signaling
EPHB-mediated forward signaling
Ephrin signaling
EPH-ephrin mediated repulsion of cells
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Agenesis of corpus callosum Agenesis of corpus callosum rs754914260, rs1057519053, rs1057519056, rs1057519054, rs1057519055, rs1057519057, rs1384496494, rs1599017933
Brachydactyly Brachydactyly rs121908949, rs28937580, rs121909082, rs104894122, rs863223289, rs863223290, rs104894121, rs1587657302, rs863223292, rs74315386, rs74315387, rs28936397, rs753691079, rs121909348, rs121917852
View all (22 more)
Congenital diaphragmatic hernia Congenital diaphragmatic hernia rs121908602, rs121908604, rs864309713, rs775394591
Coronal craniosynostosis Coronal craniosynostosis rs1566992093
Unknown
Disease term Disease name Evidence References Source
Trigonocephaly Trigonocephaly 15166289 ClinVar
Schizophrenia Schizophrenia GWAS
Associations from Text Mining
Disease Name Relationship Type References
Acrocephalosyndactylia Associate 29215649, 30651579
Adenocarcinoma Stimulate 12136247
Adenocarcinoma Associate 30058095
Borderline Personality Disorder Associate 25612291
Brain Neoplasms Associate 34544797
Breast Neoplasms Associate 22279592, 24240587, 26673618, 34544797
Capillary Malformation Arteriovenous Malformation Associate 15124102
Cholangiocarcinoma Associate 25012246
Colorectal Neoplasms Associate 33525395
Craniofrontonasal dysplasia Associate 15124102, 16685650, 20565770, 23335590, 28238796