Gene Gene information from NCBI Gene database.
Entrez ID 1946
Gene name Ephrin A5
Gene symbol EFNA5
Synonyms (NCBI Gene)
AF1EFL5EPLG7GLC1MLERK7RAGS
Chromosome 5
Chromosome location 5q21.3
Summary Ephrin-A5, a member of the ephrin gene family, prevents axon bundling in cocultures of cortical neurons with astrocytes, a model of late stage nervous system development and differentiation. The EPH and EPH-related receptors comprise the largest subfamily
miRNA miRNA information provided by mirtarbase database.
768
miRTarBase ID miRNA Experiments Reference
MIRT018356 hsa-miR-335-5p Microarray 18185580
MIRT049051 hsa-miR-92a-3p CLASH 23622248
MIRT658811 hsa-miR-10a-3p HITS-CLIP 23824327
MIRT658810 hsa-miR-362-5p HITS-CLIP 23824327
MIRT658809 hsa-miR-500b-5p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
56
GO ID Ontology Definition Evidence Reference
GO:0005168 Function Neurotrophin TRKA receptor binding NAS 19036963
GO:0005169 Function Neurotrophin TRKB receptor binding IEA
GO:0005169 Function Neurotrophin TRKB receptor binding NAS 19036963
GO:0005170 Function Neurotrophin TRKC receptor binding NAS 19036963
GO:0005515 Function Protein binding IPI 19836338, 20228801, 20505120, 22036564, 23812375, 32296183, 33961781
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
601535 3225 ENSG00000184349
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P52803
Protein name Ephrin-A5 (AL-1) (EPH-related receptor tyrosine kinase ligand 7) (LERK-7)
Protein function Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on ad
PDB 2X11 , 3MX0 , 4BK5 , 4BKA , 4L0P , 4M4R
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00812 Ephrin 29 158 Ephrin Domain
Sequence
MLHVEMLTLVFLVLWMCVFSQDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDV
FCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQL
FTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFV
RPTNSCMKTIGVHDRVFDVNDK
VENSLEPADDTVHESAEPSRGENAAQTPRIPSRLLAILLFLLAMLLTL
Sequence length 228
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Axon guidance
MicroRNAs in cancer
  EPH-Ephrin signaling
EPHA-mediated growth cone collapse
EPH-ephrin mediated repulsion of cells