Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1946
Gene name Gene Name - the full gene name approved by the HGNC.
Ephrin A5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
EFNA5
Synonyms (NCBI Gene) Gene synonyms aliases
AF1, EFL5, EPLG7, GLC1M, LERK7, RAGS
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q21.3
Summary Summary of gene provided in NCBI Entrez Gene.
Ephrin-A5, a member of the ephrin gene family, prevents axon bundling in cocultures of cortical neurons with astrocytes, a model of late stage nervous system development and differentiation. The EPH and EPH-related receptors comprise the largest subfamily
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT018356 hsa-miR-335-5p Microarray 18185580
MIRT049051 hsa-miR-92a-3p CLASH 23622248
MIRT658811 hsa-miR-10a-3p HITS-CLIP 23824327
MIRT658810 hsa-miR-362-5p HITS-CLIP 23824327
MIRT658809 hsa-miR-500b-5p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005168 Function Neurotrophin TRKA receptor binding NAS 19036963
GO:0005169 Function Neurotrophin TRKB receptor binding IEA
GO:0005169 Function Neurotrophin TRKB receptor binding NAS 19036963
GO:0005170 Function Neurotrophin TRKC receptor binding NAS 19036963
GO:0005515 Function Protein binding IPI 19836338, 20228801, 20505120, 22036564, 23812375, 32296183, 33961781
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601535 3225 ENSG00000184349
Protein
UniProt ID P52803
Protein name Ephrin-A5 (AL-1) (EPH-related receptor tyrosine kinase ligand 7) (LERK-7)
Protein function Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on ad
PDB 2X11 , 3MX0 , 4BK5 , 4BKA , 4L0P , 4M4R
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00812 Ephrin 29 158 Ephrin Domain
Sequence
MLHVEMLTLVFLVLWMCVFSQDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDV
FCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQL
FTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFV
RPTNSCMKTIGVHDRVFDVNDK
VENSLEPADDTVHESAEPSRGENAAQTPRIPSRLLAILLFLLAMLLTL
Sequence length 228
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Axon guidance
MicroRNAs in cancer
  EPH-Ephrin signaling
EPHA-mediated growth cone collapse
EPH-ephrin mediated repulsion of cells
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Insomnia Insomnia N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Schizophrenia Schizophrenia N/A N/A GWAS
Stress Disorder Post-traumatic stress disorder N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 35945523
Alzheimer Disease Associate 19668339
Anophthalmia with pulmonary hypoplasia Associate 34824448
Aortic Aneurysm Abdominal Associate 11854734
Arterial Occlusive Diseases Associate 11854734
Blast Crisis Associate 33557955
Breast Neoplasms Associate 33977106
Carcinogenesis Associate 25735347, 36228010
Carcinoma Hepatocellular Associate 22860012
Cerebral Palsy Associate 33557955