Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1902
Gene name Gene Name - the full gene name approved by the HGNC.	Lysophosphatidic acid receptor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	LPAR1
Synonyms (NCBI Gene) Gene synonyms aliases	EDG2, Gpcr26, LPA1, Mrec1.3, VZG1, edg-2, rec.1.3, vzg-1
Chromosome Chromosome number	9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	9q31.3
Summary Summary of gene provided in NCBI Entrez Gene.	The integral membrane protein encoded by this gene is a lysophosphatidic acid (LPA) receptor from a group known as EDG receptors. These receptors are members of the G protein-coupled receptor superfamily. Utilized by LPA for cell signaling, EDG receptors

Show/Hide all(353)

miRTarBase ID	miRNA	Experiments	Reference
MIRT007343	hsa-miR-200c-3p	Luciferase reporter assay, qRT-PCR, Western blot	23272142
MIRT054919	hsa-miR-23a-3p	Luciferase reporter assay, qRT-PCR, Western blot	23711961
MIRT737428	hsa-miR-892b	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR	31851778
MIRT1115421	hsa-miR-1238	CLIP-seq
MIRT1115422	hsa-miR-2116	CLIP-seq
MIRT1115423	hsa-miR-300	CLIP-seq
MIRT1115424	hsa-miR-3119	CLIP-seq
MIRT1115425	hsa-miR-3136-5p	CLIP-seq
MIRT1115426	hsa-miR-335	CLIP-seq
MIRT1115427	hsa-miR-3646	CLIP-seq
MIRT1115428	hsa-miR-381	CLIP-seq
MIRT1115429	hsa-miR-3977	CLIP-seq
MIRT1115430	hsa-miR-410	CLIP-seq
MIRT1115431	hsa-miR-4439	CLIP-seq
MIRT1115432	hsa-miR-4452	CLIP-seq
MIRT1115433	hsa-miR-4473	CLIP-seq
MIRT1115434	hsa-miR-4635	CLIP-seq
MIRT1115435	hsa-miR-4643	CLIP-seq
MIRT1115436	hsa-miR-466	CLIP-seq
MIRT1115437	hsa-miR-4666-3p	CLIP-seq
MIRT1115438	hsa-miR-4677-5p	CLIP-seq
MIRT1115439	hsa-miR-4696	CLIP-seq
MIRT1115440	hsa-miR-4789-3p	CLIP-seq
MIRT1115441	hsa-miR-512-3p	CLIP-seq
MIRT1115442	hsa-miR-520f	CLIP-seq
MIRT1115443	hsa-miR-526b	CLIP-seq
MIRT1115444	hsa-miR-548l	CLIP-seq
MIRT1115445	hsa-miR-548n	CLIP-seq
MIRT1115446	hsa-miR-656	CLIP-seq
MIRT1115447	hsa-miR-671-5p	CLIP-seq
MIRT1115448	hsa-miR-943	CLIP-seq
MIRT1550883	hsa-miR-1305	CLIP-seq
MIRT2262997	hsa-miR-155	CLIP-seq
MIRT2262998	hsa-miR-365	CLIP-seq
MIRT2262999	hsa-miR-582-5p	CLIP-seq
MIRT1550883	hsa-miR-1305	CLIP-seq
MIRT2430829	hsa-miR-186	CLIP-seq
MIRT2430830	hsa-miR-205	CLIP-seq
MIRT2430831	hsa-miR-219-1-3p	CLIP-seq
MIRT2430832	hsa-miR-23a	CLIP-seq
MIRT2430833	hsa-miR-23b	CLIP-seq
MIRT2430834	hsa-miR-23c	CLIP-seq
MIRT2430835	hsa-miR-3074-3p	CLIP-seq
MIRT2430836	hsa-miR-3591-5p	CLIP-seq
MIRT2430837	hsa-miR-4255	CLIP-seq
MIRT2430838	hsa-miR-4275	CLIP-seq
MIRT2430839	hsa-miR-4735-5p	CLIP-seq
MIRT2430840	hsa-miR-4775	CLIP-seq
MIRT2430841	hsa-miR-500a	CLIP-seq
MIRT2430842	hsa-miR-571	CLIP-seq
MIRT2430843	hsa-miR-590-3p	CLIP-seq
MIRT2430844	hsa-miR-616	CLIP-seq
MIRT2438397	hsa-miR-1224-3p	CLIP-seq
MIRT2438398	hsa-miR-1225-5p	CLIP-seq
MIRT2438399	hsa-miR-1228	CLIP-seq
MIRT2438400	hsa-miR-146b-3p	CLIP-seq
MIRT2438401	hsa-miR-3128	CLIP-seq
MIRT2438402	hsa-miR-3132	CLIP-seq
MIRT2438403	hsa-miR-3157-3p	CLIP-seq
MIRT2438404	hsa-miR-3173-5p	CLIP-seq
MIRT2438405	hsa-miR-3200-3p	CLIP-seq
MIRT2438406	hsa-miR-4278	CLIP-seq
MIRT2438407	hsa-miR-4716-3p	CLIP-seq
MIRT2438408	hsa-miR-4723-5p	CLIP-seq
MIRT1115445	hsa-miR-548n	CLIP-seq
MIRT2438409	hsa-miR-548t	CLIP-seq
MIRT2438410	hsa-miR-767-5p	CLIP-seq
MIRT2438411	hsa-miR-874	CLIP-seq
MIRT2438397	hsa-miR-1224-3p	CLIP-seq
MIRT2438398	hsa-miR-1225-5p	CLIP-seq
MIRT2438399	hsa-miR-1228	CLIP-seq
MIRT2562401	hsa-miR-1264	CLIP-seq
MIRT1550883	hsa-miR-1305	CLIP-seq
MIRT2562402	hsa-miR-1468	CLIP-seq
MIRT2438400	hsa-miR-146b-3p	CLIP-seq
MIRT2562403	hsa-miR-181a	CLIP-seq
MIRT2562404	hsa-miR-181b	CLIP-seq
MIRT2562405	hsa-miR-181c	CLIP-seq
MIRT2562406	hsa-miR-181d	CLIP-seq
MIRT2430829	hsa-miR-186	CLIP-seq
MIRT2562407	hsa-miR-188-5p	CLIP-seq
MIRT2562408	hsa-miR-200b	CLIP-seq
MIRT2562409	hsa-miR-200c	CLIP-seq
MIRT2562410	hsa-miR-204	CLIP-seq
MIRT2430830	hsa-miR-205	CLIP-seq
MIRT2562411	hsa-miR-211	CLIP-seq
MIRT1115422	hsa-miR-2116	CLIP-seq
MIRT2430831	hsa-miR-219-1-3p	CLIP-seq
MIRT2562412	hsa-miR-224	CLIP-seq
MIRT2430832	hsa-miR-23a	CLIP-seq
MIRT2430833	hsa-miR-23b	CLIP-seq
MIRT2430834	hsa-miR-23c	CLIP-seq
MIRT2562413	hsa-miR-296-3p	CLIP-seq
MIRT2430835	hsa-miR-3074-3p	CLIP-seq
MIRT2438401	hsa-miR-3128	CLIP-seq
MIRT2438402	hsa-miR-3132	CLIP-seq
MIRT2562414	hsa-miR-3148	CLIP-seq
MIRT2562415	hsa-miR-3151	CLIP-seq
MIRT2562416	hsa-miR-3154	CLIP-seq
MIRT2438403	hsa-miR-3157-3p	CLIP-seq
MIRT2438404	hsa-miR-3173-5p	CLIP-seq
MIRT2562417	hsa-miR-3183	CLIP-seq
MIRT2438405	hsa-miR-3200-3p	CLIP-seq
MIRT2562418	hsa-miR-323b-5p	CLIP-seq
MIRT1115426	hsa-miR-335	CLIP-seq
MIRT2562419	hsa-miR-337-3p	CLIP-seq
MIRT2562420	hsa-miR-339-5p	CLIP-seq
MIRT2562421	hsa-miR-33a	CLIP-seq
MIRT2562422	hsa-miR-33b	CLIP-seq
MIRT2562423	hsa-miR-342-3p	CLIP-seq
MIRT2430836	hsa-miR-3591-5p	CLIP-seq
MIRT2562424	hsa-miR-3613-5p	CLIP-seq
MIRT2562425	hsa-miR-362-5p	CLIP-seq
MIRT1115427	hsa-miR-3646	CLIP-seq
MIRT2562426	hsa-miR-3665	CLIP-seq
MIRT2562427	hsa-miR-3676	CLIP-seq
MIRT2562428	hsa-miR-3685	CLIP-seq
MIRT2562429	hsa-miR-3691-5p	CLIP-seq
MIRT2562430	hsa-miR-380	CLIP-seq
MIRT2562431	hsa-miR-382	CLIP-seq
MIRT2562432	hsa-miR-384	CLIP-seq
MIRT2562433	hsa-miR-3934	CLIP-seq
MIRT2562434	hsa-miR-3938	CLIP-seq
MIRT2562435	hsa-miR-3942-3p	CLIP-seq
MIRT1115430	hsa-miR-410	CLIP-seq
MIRT2430837	hsa-miR-4255	CLIP-seq
MIRT2562436	hsa-miR-4262	CLIP-seq
MIRT2562437	hsa-miR-4264	CLIP-seq
MIRT2562438	hsa-miR-4265	CLIP-seq
MIRT2562439	hsa-miR-4272	CLIP-seq
MIRT2562440	hsa-miR-4274	CLIP-seq
MIRT2430838	hsa-miR-4275	CLIP-seq
MIRT2438406	hsa-miR-4278	CLIP-seq
MIRT2562441	hsa-miR-4279	CLIP-seq
MIRT2562442	hsa-miR-4280	CLIP-seq
MIRT2562443	hsa-miR-429	CLIP-seq
MIRT2562444	hsa-miR-4296	CLIP-seq
MIRT2562445	hsa-miR-4320	CLIP-seq
MIRT2562446	hsa-miR-4322	CLIP-seq
MIRT2562447	hsa-miR-4326	CLIP-seq
MIRT2562448	hsa-miR-4328	CLIP-seq
MIRT2562449	hsa-miR-433	CLIP-seq
MIRT2562450	hsa-miR-4447	CLIP-seq
MIRT2562451	hsa-miR-4450	CLIP-seq
MIRT1115432	hsa-miR-4452	CLIP-seq
MIRT2562452	hsa-miR-4472	CLIP-seq
MIRT2562453	hsa-miR-4474-3p	CLIP-seq
MIRT2562454	hsa-miR-4474-5p	CLIP-seq
MIRT2562455	hsa-miR-4475	CLIP-seq
MIRT2562456	hsa-miR-4477a	CLIP-seq
MIRT2562457	hsa-miR-4495	CLIP-seq
MIRT2562458	hsa-miR-455-3p	CLIP-seq
MIRT1115434	hsa-miR-4635	CLIP-seq
MIRT2562459	hsa-miR-4659a-3p	CLIP-seq
MIRT2562460	hsa-miR-4659b-3p	CLIP-seq
MIRT2562461	hsa-miR-4668-5p	CLIP-seq
MIRT2562462	hsa-miR-4670-3p	CLIP-seq
MIRT2562463	hsa-miR-4676-5p	CLIP-seq
MIRT1115438	hsa-miR-4677-5p	CLIP-seq
MIRT2562464	hsa-miR-4687-3p	CLIP-seq
MIRT2562465	hsa-miR-4691-5p	CLIP-seq
MIRT2562466	hsa-miR-4694-3p	CLIP-seq
MIRT1115439	hsa-miR-4696	CLIP-seq
MIRT2562467	hsa-miR-4715-3p	CLIP-seq
MIRT2438407	hsa-miR-4716-3p	CLIP-seq
MIRT2562468	hsa-miR-4719	CLIP-seq
MIRT2562469	hsa-miR-4723-3p	CLIP-seq
MIRT2438408	hsa-miR-4723-5p	CLIP-seq
MIRT2562470	hsa-miR-4728-3p	CLIP-seq
MIRT2430839	hsa-miR-4735-5p	CLIP-seq
MIRT2562471	hsa-miR-4752	CLIP-seq
MIRT2430840	hsa-miR-4775	CLIP-seq
MIRT2562472	hsa-miR-4797-3p	CLIP-seq
MIRT2562473	hsa-miR-4799-5p	CLIP-seq
MIRT2562474	hsa-miR-4802-5p	CLIP-seq
MIRT2562475	hsa-miR-485-5p	CLIP-seq
MIRT2562476	hsa-miR-488	CLIP-seq
MIRT2562477	hsa-miR-491-5p	CLIP-seq
MIRT2430841	hsa-miR-500a	CLIP-seq
MIRT2562478	hsa-miR-500b	CLIP-seq
MIRT2562479	hsa-miR-501-5p	CLIP-seq
MIRT2562480	hsa-miR-508-5p	CLIP-seq
MIRT2562481	hsa-miR-520a-5p	CLIP-seq
MIRT2562482	hsa-miR-522	CLIP-seq
MIRT2562483	hsa-miR-525-5p	CLIP-seq
MIRT1115443	hsa-miR-526b	CLIP-seq
MIRT2562484	hsa-miR-548c-3p	CLIP-seq
MIRT1115445	hsa-miR-548n	CLIP-seq
MIRT2438409	hsa-miR-548t	CLIP-seq
MIRT2430842	hsa-miR-571	CLIP-seq
MIRT2562485	hsa-miR-575	CLIP-seq
MIRT2562486	hsa-miR-581	CLIP-seq
MIRT2262999	hsa-miR-582-5p	CLIP-seq
MIRT2562487	hsa-miR-584	CLIP-seq
MIRT2430843	hsa-miR-590-3p	CLIP-seq
MIRT2562488	hsa-miR-605	CLIP-seq
MIRT2562489	hsa-miR-615-5p	CLIP-seq
MIRT2430844	hsa-miR-616	CLIP-seq
MIRT2562490	hsa-miR-644	CLIP-seq
MIRT2562491	hsa-miR-657	CLIP-seq
MIRT2562492	hsa-miR-659	CLIP-seq
MIRT2562493	hsa-miR-665	CLIP-seq
MIRT2562494	hsa-miR-670	CLIP-seq
MIRT1115447	hsa-miR-671-5p	CLIP-seq
MIRT2438410	hsa-miR-767-5p	CLIP-seq
MIRT2562495	hsa-miR-873	CLIP-seq
MIRT2438411	hsa-miR-874	CLIP-seq
MIRT2562496	hsa-miR-889	CLIP-seq
MIRT2438397	hsa-miR-1224-3p	CLIP-seq
MIRT2438398	hsa-miR-1225-5p	CLIP-seq
MIRT2438399	hsa-miR-1228	CLIP-seq
MIRT2684075	hsa-miR-1261	CLIP-seq
MIRT2562401	hsa-miR-1264	CLIP-seq
MIRT2684076	hsa-miR-1287	CLIP-seq
MIRT1550883	hsa-miR-1305	CLIP-seq
MIRT2562402	hsa-miR-1468	CLIP-seq
MIRT2438400	hsa-miR-146b-3p	CLIP-seq
MIRT2562403	hsa-miR-181a	CLIP-seq
MIRT2562404	hsa-miR-181b	CLIP-seq
MIRT2562405	hsa-miR-181c	CLIP-seq
MIRT2562406	hsa-miR-181d	CLIP-seq
MIRT2430829	hsa-miR-186	CLIP-seq
MIRT2562407	hsa-miR-188-5p	CLIP-seq
MIRT2562408	hsa-miR-200b	CLIP-seq
MIRT2562409	hsa-miR-200c	CLIP-seq
MIRT2562410	hsa-miR-204	CLIP-seq
MIRT2430830	hsa-miR-205	CLIP-seq
MIRT2562411	hsa-miR-211	CLIP-seq
MIRT2684077	hsa-miR-2114	CLIP-seq
MIRT1115422	hsa-miR-2116	CLIP-seq
MIRT2430831	hsa-miR-219-1-3p	CLIP-seq
MIRT2684078	hsa-miR-2278	CLIP-seq
MIRT2430832	hsa-miR-23a	CLIP-seq
MIRT2430833	hsa-miR-23b	CLIP-seq
MIRT2430834	hsa-miR-23c	CLIP-seq
MIRT2562413	hsa-miR-296-3p	CLIP-seq
MIRT2430835	hsa-miR-3074-3p	CLIP-seq
MIRT2438401	hsa-miR-3128	CLIP-seq
MIRT2438402	hsa-miR-3132	CLIP-seq
MIRT2562414	hsa-miR-3148	CLIP-seq
MIRT2562415	hsa-miR-3151	CLIP-seq
MIRT2562416	hsa-miR-3154	CLIP-seq
MIRT2438403	hsa-miR-3157-3p	CLIP-seq
MIRT2438404	hsa-miR-3173-5p	CLIP-seq
MIRT2562417	hsa-miR-3183	CLIP-seq
MIRT2438405	hsa-miR-3200-3p	CLIP-seq
MIRT2562418	hsa-miR-323b-5p	CLIP-seq
MIRT1115426	hsa-miR-335	CLIP-seq
MIRT2562419	hsa-miR-337-3p	CLIP-seq
MIRT2562420	hsa-miR-339-5p	CLIP-seq
MIRT2562421	hsa-miR-33a	CLIP-seq
MIRT2562422	hsa-miR-33b	CLIP-seq
MIRT2562423	hsa-miR-342-3p	CLIP-seq
MIRT2430836	hsa-miR-3591-5p	CLIP-seq
MIRT2562424	hsa-miR-3613-5p	CLIP-seq
MIRT2562425	hsa-miR-362-5p	CLIP-seq
MIRT1115427	hsa-miR-3646	CLIP-seq
MIRT2562426	hsa-miR-3665	CLIP-seq
MIRT2562427	hsa-miR-3676	CLIP-seq
MIRT2562428	hsa-miR-3685	CLIP-seq
MIRT2562429	hsa-miR-3691-5p	CLIP-seq
MIRT2684079	hsa-miR-371-5p	CLIP-seq
MIRT2562430	hsa-miR-380	CLIP-seq
MIRT2562431	hsa-miR-382	CLIP-seq
MIRT2562432	hsa-miR-384	CLIP-seq
MIRT2562433	hsa-miR-3934	CLIP-seq
MIRT2562434	hsa-miR-3938	CLIP-seq
MIRT2562435	hsa-miR-3942-3p	CLIP-seq
MIRT1115430	hsa-miR-410	CLIP-seq
MIRT2430837	hsa-miR-4255	CLIP-seq
MIRT2562436	hsa-miR-4262	CLIP-seq
MIRT2562437	hsa-miR-4264	CLIP-seq
MIRT2562438	hsa-miR-4265	CLIP-seq
MIRT2562439	hsa-miR-4272	CLIP-seq
MIRT2562440	hsa-miR-4274	CLIP-seq
MIRT2430838	hsa-miR-4275	CLIP-seq
MIRT2438406	hsa-miR-4278	CLIP-seq
MIRT2562441	hsa-miR-4279	CLIP-seq
MIRT2562442	hsa-miR-4280	CLIP-seq
MIRT2562443	hsa-miR-429	CLIP-seq
MIRT2562444	hsa-miR-4296	CLIP-seq
MIRT2562445	hsa-miR-4320	CLIP-seq
MIRT2562446	hsa-miR-4322	CLIP-seq
MIRT2562447	hsa-miR-4326	CLIP-seq
MIRT2562448	hsa-miR-4328	CLIP-seq
MIRT2562449	hsa-miR-433	CLIP-seq
MIRT2562450	hsa-miR-4447	CLIP-seq
MIRT2562451	hsa-miR-4450	CLIP-seq
MIRT1115432	hsa-miR-4452	CLIP-seq
MIRT2562452	hsa-miR-4472	CLIP-seq
MIRT2562453	hsa-miR-4474-3p	CLIP-seq
MIRT2562454	hsa-miR-4474-5p	CLIP-seq
MIRT2562455	hsa-miR-4475	CLIP-seq
MIRT2562456	hsa-miR-4477a	CLIP-seq
MIRT2684080	hsa-miR-4487	CLIP-seq
MIRT2562457	hsa-miR-4495	CLIP-seq
MIRT2562458	hsa-miR-455-3p	CLIP-seq
MIRT1115434	hsa-miR-4635	CLIP-seq
MIRT2562459	hsa-miR-4659a-3p	CLIP-seq
MIRT2562460	hsa-miR-4659b-3p	CLIP-seq
MIRT2562461	hsa-miR-4668-5p	CLIP-seq
MIRT2562462	hsa-miR-4670-3p	CLIP-seq
MIRT2562463	hsa-miR-4676-5p	CLIP-seq
MIRT1115438	hsa-miR-4677-5p	CLIP-seq
MIRT2562464	hsa-miR-4687-3p	CLIP-seq
MIRT2562465	hsa-miR-4691-5p	CLIP-seq
MIRT2562466	hsa-miR-4694-3p	CLIP-seq
MIRT1115439	hsa-miR-4696	CLIP-seq
MIRT2562467	hsa-miR-4715-3p	CLIP-seq
MIRT2438407	hsa-miR-4716-3p	CLIP-seq
MIRT2562468	hsa-miR-4719	CLIP-seq
MIRT2562469	hsa-miR-4723-3p	CLIP-seq
MIRT2438408	hsa-miR-4723-5p	CLIP-seq
MIRT2562470	hsa-miR-4728-3p	CLIP-seq
MIRT2430839	hsa-miR-4735-5p	CLIP-seq
MIRT2562471	hsa-miR-4752	CLIP-seq
MIRT2430840	hsa-miR-4775	CLIP-seq
MIRT2562472	hsa-miR-4797-3p	CLIP-seq
MIRT2562473	hsa-miR-4799-5p	CLIP-seq
MIRT2562474	hsa-miR-4802-5p	CLIP-seq
MIRT2562475	hsa-miR-485-5p	CLIP-seq
MIRT2562476	hsa-miR-488	CLIP-seq
MIRT2562477	hsa-miR-491-5p	CLIP-seq
MIRT2430841	hsa-miR-500a	CLIP-seq
MIRT2562478	hsa-miR-500b	CLIP-seq
MIRT2562479	hsa-miR-501-5p	CLIP-seq
MIRT2562480	hsa-miR-508-5p	CLIP-seq
MIRT2562481	hsa-miR-520a-5p	CLIP-seq
MIRT2562482	hsa-miR-522	CLIP-seq
MIRT2562483	hsa-miR-525-5p	CLIP-seq
MIRT1115443	hsa-miR-526b	CLIP-seq
MIRT2562484	hsa-miR-548c-3p	CLIP-seq
MIRT1115445	hsa-miR-548n	CLIP-seq
MIRT2438409	hsa-miR-548t	CLIP-seq
MIRT2430842	hsa-miR-571	CLIP-seq
MIRT2562485	hsa-miR-575	CLIP-seq
MIRT2562486	hsa-miR-581	CLIP-seq
MIRT2262999	hsa-miR-582-5p	CLIP-seq
MIRT2562487	hsa-miR-584	CLIP-seq
MIRT2430843	hsa-miR-590-3p	CLIP-seq
MIRT2562488	hsa-miR-605	CLIP-seq
MIRT2562489	hsa-miR-615-5p	CLIP-seq
MIRT2430844	hsa-miR-616	CLIP-seq
MIRT2562490	hsa-miR-644	CLIP-seq
MIRT2562491	hsa-miR-657	CLIP-seq
MIRT2562492	hsa-miR-659	CLIP-seq
MIRT2562493	hsa-miR-665	CLIP-seq
MIRT2562494	hsa-miR-670	CLIP-seq
MIRT1115447	hsa-miR-671-5p	CLIP-seq
MIRT2438410	hsa-miR-767-5p	CLIP-seq
MIRT2562495	hsa-miR-873	CLIP-seq
MIRT2438411	hsa-miR-874	CLIP-seq
MIRT2562496	hsa-miR-889	CLIP-seq

Show/Hide all(77)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001965	Function	G-protein alpha-subunit binding	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	8922387
GO:0005515	Function	Protein binding	IPI	19306925
GO:0005543	Function	Phospholipid binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005768	Component	Endosome	IDA	19306925
GO:0005768	Component	Endosome	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	19306925
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS	9070858
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	19306925
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	8922387
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IEA
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	ISS
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IMP	19733258
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	TAS	9804623
GO:0008289	Function	Lipid binding	IEA
GO:0008360	Process	Regulation of cell shape	IEA
GO:0008360	Process	Regulation of cell shape	ISS
GO:0009986	Component	Cell surface	IDA	19306925
GO:0009986	Component	Cell surface	IEA
GO:0010977	Process	Negative regulation of neuron projection development	IEA
GO:0010977	Process	Negative regulation of neuron projection development	ISS
GO:0014003	Process	Oligodendrocyte development	IEA
GO:0016020	Component	Membrane	IEA
GO:0021549	Process	Cerebellum development	IEA
GO:0021554	Process	Optic nerve development	IEA
GO:0022008	Process	Neurogenesis	IBA
GO:0022008	Process	Neurogenesis	IEA
GO:0022038	Process	Corpus callosum development	IEA
GO:0030139	Component	Endocytic vesicle	IDA	19306925
GO:0030165	Function	PDZ domain binding	IEA
GO:0032060	Process	Bleb assembly	IEA
GO:0035025	Process	Positive regulation of Rho protein signal transduction	IEA
GO:0035025	Process	Positive regulation of Rho protein signal transduction	ISS
GO:0035727	Function	Lysophosphatidic acid binding	IDA	9070858
GO:0042552	Process	Myelination	IEA
GO:0042734	Component	Presynaptic membrane	IEA
GO:0043001	Process	Golgi to plasma membrane protein transport	IMP	25673879
GO:0043025	Component	Neuronal cell body	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEP	12761501
GO:0043197	Component	Dendritic spine	IEA
GO:0043198	Component	Dendritic shaft	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	ISS
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0045724	Process	Positive regulation of cilium assembly	IDA	26258637
GO:0045724	Process	Positive regulation of cilium assembly	IMP	25673879, 31204173
GO:0051496	Process	Positive regulation of stress fiber assembly	IEA
GO:0051496	Process	Positive regulation of stress fiber assembly	ISS
GO:0060326	Process	Cell chemotaxis	IMP	19733258
GO:0060627	Process	Regulation of vesicle-mediated transport	IMP	31204173
GO:0060999	Process	Positive regulation of dendritic spine development	IEA
GO:0061512	Process	Protein localization to cilium	IMP	25673879
GO:0070915	Function	Lysophosphatidic acid receptor activity	IBA
GO:0070915	Function	Lysophosphatidic acid receptor activity	IDA	19306925
GO:0070915	Function	Lysophosphatidic acid receptor activity	IEA
GO:0070915	Function	Lysophosphatidic acid receptor activity	IMP	9070858
GO:0071453	Process	Cellular response to oxygen levels	IEA
GO:0071673	Process	Positive regulation of smooth muscle cell chemotaxis	IEA
GO:0098693	Process	Regulation of synaptic vesicle cycle	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0098982	Component	GABA-ergic synapse	IEA
GO:0099149	Process	Regulation of postsynaptic neurotransmitter receptor internalization	IEA
GO:0141162	Process	Negative regulation of cAMP/PKA signal transduction	IEA
GO:1902018	Process	Negative regulation of cilium assembly	IDA	31204173
GO:1902018	Process	Negative regulation of cilium assembly	IMP	31204173
GO:1904566	Process	Cellular response to 1-oleoyl-sn-glycerol 3-phosphate	IEA

MIM	HGNC	e!Ensembl
602282	3166	ENSG00000198121

Protein

UniProt ID

Q92633

Protein name

Lysophosphatidic acid receptor 1 (LPA receptor 1) (LPA-1) (Lysophosphatidic acid receptor Edg-2)

Protein function

Receptor for lysophosphatidic acid (LPA) (PubMed:19306925, PubMed:25025571, PubMed:26091040, PubMed:9070858). Plays a role in the reorganization of the actin cytoskeleton, cell migration, differentiation and proliferation, and thereby contribute

PDB

4Z34 , 4Z35 , 4Z36 , 7TD0 , 7TD1 , 7TD2 , 7YU3 , 7YU4 , 7YU5 , 7YU6 , 7YU7 , 7YU8 , 9IZF , 9IZG , 9IZH , 9J5V

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	66 → 311	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in many adult organs, including brain, heart, colon, small intestine, placenta, prostate, ovary, pancreas, testes, spleen, skeletal muscle, and kidney. Little or no expression in liver, lung, thymus, or peripheral blood leuko

Sequence

MAAISTSIPVISQPQFTAMNEPQCFYNESIAFFYNRSGKHLATEWNTVSKLVMGLGITVC
IFIMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVST
WLLRQGLIDTSLTASVANLLAIAIERHITVFRMQLHTRMSNRRVVVVIVVIWTMAIVMGA
IPSVGWNCICDIENCSNMAPLYSDSYLVFWAIFNLVTFVVMVVLYAHIFGYVRQRTMRMS
RHSSGPRRNRDTMMSLLKTVVIVLGAFIICWTPGLVLLLLDVCCPQCDVLAYEKFFLLLA
EFNSAMNPIIYSYRDKEMSATFRQILCCQRSENPTGPTEGSDRSASSLNHTILAGVHSND
HSVV

Sequence length

364

Interactions

View interactions

	KEGG		Reactome
	Rap1 signaling pathway Phospholipase D signaling pathway Neuroactive ligand-receptor interaction PI3K-Akt signaling pathway Gap junction Regulation of actin cytoskeleton Pathogenic Escherichia coli infection Pathways in cancer		G alpha (q) signalling events G alpha (i) signalling events Lysosphingolipid and LPA receptors

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Colorectal Cancer	Colorectal cancer	N/A	N/A	GWAS
Lung adenocarcinoma	Lung adenocarcinoma	N/A	N/A	GWAS

Show/Hide Text Mining Associations (46)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenomyosis	Stimulate	29178922
Anxiety	Associate	28969474
Apnea	Associate	23155414
Arthritis Rheumatoid	Associate	22354754
Astrocytoma	Associate	33916643
Breast Neoplasms	Associate	17496233, 19609003, 23405264, 31035435, 37372960, 38578146
Carcinogenesis	Associate	36879212
Carcinoma	Stimulate	31455351
Carcinoma Basal Cell	Associate	34104083
Carcinoma Hepatocellular	Stimulate	26701886
Carcinoma Non Small Cell Lung	Associate	38124403
Carcinoma Pancreatic Ductal	Associate	36879212
Colorectal Neoplasms	Associate	15220934, 31137244, 35545337
Endometrial Neoplasms	Associate	29182028, 29328374
Gingival Overgrowth	Associate	32455102
Glioblastoma	Associate	16627485, 33916643, 36229835
Hypothyroidism Congenital Nongoitrous 2	Associate	32727237
Hypoxia	Associate	29866927
IgA Vasculitis	Associate	22354754
Inflammation	Associate	35491409
Kidney Neoplasms	Associate	35857125
Leukemia Lymphocytic Chronic B Cell	Associate	15618220
Liver Neoplasms	Associate	26701886
Lung Diseases	Associate	36257596
Lung Neoplasms	Associate	38124403
Lupus Erythematosus Systemic	Associate	20659327
Lymphoma Mantle Cell	Stimulate	31455351
Mesothelioma Malignant	Associate	18754873
Neoplasm Metastasis	Associate	17531530, 29866927
Neoplasm Metastasis	Inhibit	21996742
Neoplasms	Inhibit	15220934, 15728708
Neoplasms	Associate	15837931, 16627485, 21978933, 26701886, 29866927, 30353652, 33916643, 34796980, 37372960, 9525886
Osteosarcoma	Associate	22659570
Ovarian Neoplasms	Inhibit	15728708
Pancreatic Neoplasms	Associate	28359316
Pancreatitis Chronic	Associate	36879212
Pelvic Pain	Stimulate	32727237
Precancerous Conditions	Associate	30598579
Prostatic Neoplasms	Associate	17531530, 21978933, 27474750, 30317243
Prostatic Neoplasms	Inhibit	21996742
Scleroderma Diffuse	Associate	29732731
Sleep Apnea Obstructive	Associate	23155414
Stomach Neoplasms	Associate	18701480
Thyroid Cancer Papillary	Associate	31455351
Triple Negative Breast Neoplasms	Associate	34104083
Urinary Bladder Neoplasms	Associate	29854840

LPAR1 (lysophosphatidic acid receptor 1)