Gene Gene information from NCBI Gene database.
Entrez ID 1831
Gene name TSC22 domain family member 3
Gene symbol TSC22D3
Synonyms (NCBI Gene)
DIPDSIPIGILZTSC-22R
Chromosome X
Chromosome location Xq22.3
Summary This gene encodes the anti-inflammatory protein glucocorticoid (GC)-induced leucine zipper. Expression of this gene stimulated by glucocorticoids and interleukin 10 and it appears to play a key role in the anti-inflammatory and immunosuppressive effects o
miRNA miRNA information provided by mirtarbase database.
312
miRTarBase ID miRNA Experiments Reference
MIRT004547 hsa-miR-18a-5p qRT-PCR 19131573
MIRT004548 hsa-miR-124-3p qRT-PCR 19131573
MIRT005359 hsa-miR-182-5p Luciferase reporter assayqRT-PCR 20656788
MIRT018941 hsa-miR-335-5p Microarray 18185580
MIRT050637 hsa-miR-19b-3p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol TAS
GO:0006357 Process Regulation of transcription by RNA polymerase II IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
300506 3051 ENSG00000157514
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q99576
Protein name TSC22 domain family protein 3 (DSIP-immunoreactive peptide) (Protein DIP) (hDIP) (Delta sleep-inducing peptide immunoreactor) (Glucocorticoid-induced leucine zipper protein) (GILZ) (TSC-22-like protein) (TSC-22-related protein) (TSC-22R)
Protein function Protects T-cells from IL2 deprivation-induced apoptosis through the inhibition of FOXO3A transcriptional activity that leads to the down-regulation of the pro-apoptotic factor BCL2L11 (PubMed:15031210). In macrophages, plays a role in the anti-i
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01166 TSC22 58 114 TSC-22/dip/bun family Coiled-coil
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed, including in the fetal brain and liver (PubMed:26752201). Expressed in brain, lung, spleen and skeletal muscle (PubMed:11313722, PubMed:12393603). Lower levels detected in heart and kidney (PubMed:11313722, PubM
Sequence
MNTEMYQTPMEVAVYQLHNFSISFFSSLLGGDVVSVKLDNSASGASVVAIDNKIEQAMDL
VKNHLMYAVREEVEILKEQIRELVEKNSQLERENTLLKTLASPEQLEKFQSCLS
PEEPAP
ESPQVPEAPGGSAV
Sequence length 134
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Stimuli-sensing channels