Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1831
Gene name Gene Name - the full gene name approved by the HGNC.
TSC22 domain family member 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TSC22D3
Synonyms (NCBI Gene) Gene synonyms aliases
DIP, DSIPI, GILZ, TSC-22R
Chromosome Chromosome number
X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
Xq22.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes the anti-inflammatory protein glucocorticoid (GC)-induced leucine zipper. Expression of this gene stimulated by glucocorticoids and interleukin 10 and it appears to play a key role in the anti-inflammatory and immunosuppressive effects o
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004547 hsa-miR-18a-5p qRT-PCR 19131573
MIRT004548 hsa-miR-124-3p qRT-PCR 19131573
MIRT005359 hsa-miR-182-5p Luciferase reporter assay, qRT-PCR 20656788
MIRT018941 hsa-miR-335-5p Microarray 18185580
MIRT050637 hsa-miR-19b-3p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol TAS
GO:0006357 Process Regulation of transcription by RNA polymerase II IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
300506 3051 ENSG00000157514
Protein
UniProt ID Q99576
Protein name TSC22 domain family protein 3 (DSIP-immunoreactive peptide) (Protein DIP) (hDIP) (Delta sleep-inducing peptide immunoreactor) (Glucocorticoid-induced leucine zipper protein) (GILZ) (TSC-22-like protein) (TSC-22-related protein) (TSC-22R)
Protein function Protects T-cells from IL2 deprivation-induced apoptosis through the inhibition of FOXO3A transcriptional activity that leads to the down-regulation of the pro-apoptotic factor BCL2L11 (PubMed:15031210). In macrophages, plays a role in the anti-i
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01166 TSC22 58 114 TSC-22/dip/bun family Coiled-coil
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed, including in the fetal brain and liver (PubMed:26752201). Expressed in brain, lung, spleen and skeletal muscle (PubMed:11313722, PubMed:12393603). Lower levels detected in heart and kidney (PubMed:11313722, PubM
Sequence
MNTEMYQTPMEVAVYQLHNFSISFFSSLLGGDVVSVKLDNSASGASVVAIDNKIEQAMDL
VKNHLMYAVREEVEILKEQIRELVEKNSQLERENTLLKTLASPEQLEKFQSCLS
PEEPAP
ESPQVPEAPGGSAV
Sequence length 134
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Stimuli-sensing channels
<