ARID3A (AT-rich interaction domain 3A)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 1820
Gene name AT-rich interaction domain 3A
Gene symbol ARID3A
Synonyms (NCBI Gene)
BRIGHTDRIL1DRIL3E2FBP1
Chromosome 19
Chromosome location 19p13.3
Summary This gene encodes a member of the ARID (AT-rich interaction domain) family of DNA binding proteins. It was found by homology to the Drosophila dead ringer gene, which is important for normal embryogenesis. Other ARID family members have roles in embryonic
miRNA miRNA information provided by mirtarbase database.
528
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (528)
miRTarBase ID miRNA Experiments Reference
MIRT005059 hsa-let-7b-5p Microarray 17699775
MIRT023439 hsa-miR-30b-5p Sequencing 20371350
MIRT027857 hsa-miR-98-5p Microarray 19088304
MIRT032173 hsa-let-7d-5p Sequencing 20371350
MIRT042421 hsa-miR-425-3p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
17
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (17)
GO ID Ontology Definition Evidence Reference
GO:0003677 Function DNA binding IBA
GO:0003677 Function DNA binding IEA
GO:0003682 Function Chromatin binding IEA
GO:0003712 Function Transcription coregulator activity IEA
GO:0005515 Function Protein binding IPI 19214191, 25416956, 32296183
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
603265 3031 ENSG00000116017
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q99856
Protein name AT-rich interactive domain-containing protein 3A (ARID domain-containing protein 3A) (B-cell regulator of IgH transcription) (Bright) (Dead ringer-like protein 1) (E2F-binding protein 1)
Protein function Transcription factor which may be involved in the control of cell cycle progression by the RB1/E2F1 pathway and in B-cell differentiation.
PDB 2KK0 , 4LJX
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01388 ARID 240 → 326 ARID/BRIGHT DNA binding domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed, with highest expression in skeletal muscle, thalamus, and colon.
Sequence 
MKLQAVMETLLQRQQRARQELEARQQLPPDPPAAPPGRARAAPDEDREPESARMQRAQMA
ALAAMRAAAAGLGHPASPGGSEDGPPGSEEEDAAREGTPGSPGRGREGPGEEHFEDMASD
EDMKPKWEEEEMEEDLGEDEEEEEEDYEDEEEEEDEEGLGPPGPASLGTTALFPRKAQPP
QAFRGDGVPRVLGGQERPGPGPAHPGGAAHVAPQLQPPDHGDWTYEEQFKQLYELDGDPK
RKEFLDDLFSFMQKRGTPVNRIPIMAKQVLDLFMLYVLVTEKGGLVEVINKKLWREITKG
LNLPTSITSAAFTLRTQYMKYLYPYECEKRGLSNPNELQAAIDSNRREGRRQSFGGSLFA
YSPGGAHGMLSSPKLPVSSLGLAASTNGSSITPAPKIKKEEDSAIPITVPGRLPVSLAGH
PVVAAQAAAVQAAAAQAAVAAQAAALEQLREKLESAEPPEKKMALVADEQQRLMQRALQQ
NFLAMAAQLPMSIRINSQASESRQDSAVNLTGTNGSNSISMSVEINGIMYTGVLFAQPPA
PTPTSAPNKGGGGGGGSSSNAGGRGGNTGTSGGQAGPAGLSTPSTSTSNNSLP
Sequence length 593
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    TP53 Regulates Transcription of Genes Involved in G1 Cell Cycle Arrest
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
23
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (12)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Adrenocortical carcinoma, hereditary Benign; Likely benign rs146132253 RCV005913320
Cervical cancer Benign; Likely benign rs146132253 RCV005913321
Colon adenocarcinoma Benign; Likely benign rs146132253 RCV005913318
EBV-positive nodal T- and NK-cell lymphoma Likely benign rs757309861 RCV004557783
Show/Hide Text Mining Associations (13)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 27809618
Cakut Associate 40774958
Carcinoma Hepatocellular Associate 27458175, 36008383
Fetal Growth Retardation Associate 31415216
Inflammation Associate 27522115, 30297159
Liver Cirrhosis Biliary Associate 28425483
Lupus Erythematosus Systemic Stimulate 25185498
Lupus Erythematosus Systemic Associate 26685208, 27522115, 30297159
Lymphoma Large B Cell Diffuse Associate 23424639
Migraine Disorders Associate 39833696