Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1816
Gene name Gene Name - the full gene name approved by the HGNC.	Dopamine receptor D5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DRD5
Synonyms (NCBI Gene) Gene synonyms aliases	DBDR, DRD1B, DRD1L2
Chromosome Chromosome number	4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	4p16.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes the D5 subtype of the dopamine receptor. The D5 subtype is a G-protein coupled receptor which stimulates adenylyl cyclase. This receptor is expressed in neurons in the limbic regions of the brain. It has a 10-fold higher affinity for dop

Show/Hide all(6)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017477	hsa-miR-335-5p	Microarray	18185580
MIRT945370	hsa-miR-1253	CLIP-seq
MIRT945371	hsa-miR-3184	CLIP-seq
MIRT945372	hsa-miR-423-5p	CLIP-seq
MIRT945373	hsa-miR-4477b	CLIP-seq
MIRT945374	hsa-miR-711	CLIP-seq

Show/Hide all(41)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001588	Function	Dopamine neurotransmitter receptor activity, coupled via Gs	IBA	21873635
GO:0001588	Function	Dopamine neurotransmitter receptor activity, coupled via Gs	TAS	9457173
GO:0001963	Process	Synaptic transmission, dopaminergic	NAS	11036203
GO:0001975	Process	Response to amphetamine	IEA
GO:0001992	Process	Regulation of systemic arterial blood pressure by vasopressin	IEA
GO:0001994	Process	Norepinephrine-epinephrine vasoconstriction involved in regulation of systemic arterial blood pressure	IEA
GO:0004930	Function	G protein-coupled receptor activity	IBA	21873635
GO:0004952	Function	Dopamine neurotransmitter receptor activity	IDA	1826762
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IDA	10531415, 11500503
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0005887	Component	Integral component of plasma membrane	NAS	1826762
GO:0005887	Component	Integral component of plasma membrane	TAS	9457173
GO:0005929	Component	Cilium	IDA	28154160
GO:0006874	Process	Cellular calcium ion homeostasis	TAS	9457173
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	11500503
GO:0007190	Process	Activation of adenylate cyclase activity	TAS	9457173
GO:0007191	Process	Adenylate cyclase-activating dopamine receptor signaling pathway	IDA	1826762, 18403039
GO:0007212	Process	Dopamine receptor signaling pathway	IBA	21873635
GO:0007268	Process	Chemical synaptic transmission	NAS	7727453
GO:0008306	Process	Associative learning	IEA
GO:0019226	Process	Transmission of nerve impulse	IEA
GO:0031526	Component	Brush border membrane	IEA
GO:0033861	Process	Negative regulation of NAD(P)H oxidase activity	IDA	16352863
GO:0035240	Function	Dopamine binding	IDA	1826762
GO:0042060	Process	Wound healing	IEA
GO:0042220	Process	Response to cocaine	IEA
GO:0045202	Component	Synapse	IEA
GO:0045762	Process	Positive regulation of adenylate cyclase activity	NAS	7727453
GO:0045776	Process	Negative regulation of blood pressure	IEA
GO:0045924	Process	Regulation of female receptivity	IEA
GO:0046960	Process	Sensitization	IEA
GO:0060158	Process	Phospholipase C-activating dopamine receptor signaling pathway	TAS	9457173
GO:0060170	Component	Ciliary membrane	IDA	20531939
GO:0060292	Process	Long-term synaptic depression	IEA
GO:0071870	Process	Cellular response to catecholamine stimulus	IDA	18403039
GO:0071880	Process	Adenylate cyclase-activating adrenergic receptor signaling pathway	IBA	21873635
GO:0072593	Process	Reactive oxygen species metabolic process	IDA	16352863
GO:0097730	Component	Non-motile cilium	IDA	20531939

MIM	HGNC	e!Ensembl
126453	3026	ENSG00000169676

Protein

UniProt ID

P21918

Protein name

D(1B) dopamine receptor (D(5) dopamine receptor) (D1beta dopamine receptor) (Dopamine D5 receptor)

Protein function

Dopamine receptor whose activity is mediated by G proteins which activate adenylyl cyclase.

PDB

8IRV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	57 → 359	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Neuron-specific, localized primarily within limbic regions of the brain. {ECO:0000269|PubMed:1834671}.

Sequence

MLPPGSNGTAYPGQFALYQQLAQGNAVGGSAGAPPLGPSQVVTACLLTLLIIWTLLGNVL
VCAAIVRSRHLRANMTNVFIVSLAVSDLFVALLVMPWKAVAEVAGYWPFGAFCDVWVAFD
IMCSTASILNLCVISVDRYWAISRPFRYKRKMTQRMALVMVGLAWTLSILISFIPVQLNW
HRDQAASWGGLDLPNNLANWTPWEEDFWEPDVNAENCDSSLNRTYAISSSLISFYIPVAI
MIVTYTRIYRIAQVQIRRISSLERAAEHAQSCRSSAACAPDTSLRASIKKETKVLKTLSV
IMGVFVCCWLPFFILNCMVPFCSGHPEGPPAGFPCVSETTFDVFVWFGWANSSLNPVIYA
FNADFQKVFAQLLGCSHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTP
GNREVDNDEEEGPFDRMFQIYQTSPDGDPVAESVWELDCEGEISLDKITPFTPNGFH

Sequence length

477

Interactions

View interactions

	KEGG		Reactome
	Calcium signaling pathway cAMP signaling pathway Neuroactive ligand-receptor interaction Hormone signaling Dopaminergic synapse		Dopamine receptors G alpha (s) signalling events ADORA2B mediated anti-inflammatory cytokines production

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Attention deficit hyperactivity disorder	Attention Deficit Disorder, Attention deficit hyperactivity disorder	rs786205019	14699430, 14732906

Show/Hide Unknown Diseases (2)

Disease term	Disease name	References	Source
Unknown
Mental depression	Endogenous depression, Depressive disorder, Unipolar Depression, Depressive Syndrome, Depression, Neurotic	14708030	ClinVar
Language Delay And Attention Deficit-Hyperactivity Disorder/Cognitive Impairment With Or Without Cardiac Arrhythmia	attention deficit-hyperactivity disorder		GenCC

Show/Hide Text Mining Associations (19)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenoma	Associate	29670116
Attention Deficit Disorder with Hyperactivity	Associate	11923911, 14732906, 16380908, 22562805
Breast Neoplasms	Associate	25556472
Disruptive Impulse Control and Conduct Disorders	Associate	25896831
Glioblastoma	Associate	30559168, 36477472
Glioma	Associate	28339748
HIV Infections	Associate	37376663
Inflammation	Inhibit	26808524
Leukemia	Associate	24517546
Mental Disorders	Associate	24668635
Neoplasms	Associate	29670116, 30559168, 30984543, 31702782
Obesity Abdominal	Inhibit	26808524
Parkinsonism Dystonia Infantile	Associate	24668635
Retinitis	Associate	35544697
Schizophrenia Paranoid	Associate	24668635
Small Cell Lung Carcinoma	Associate	34621500
Stomach Neoplasms	Associate	18322944
Torticollis	Associate	11459908
Vitreoretinopathy Proliferative	Associate	35544697

DRD5 (dopamine receptor D5)