Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1805
Gene name Gene Name - the full gene name approved by the HGNC.	Dermatopontin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DPT
Synonyms (NCBI Gene) Gene synonyms aliases	TRAMP
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q24.2
Summary Summary of gene provided in NCBI Entrez Gene.	Dermatopontin is an extracellular matrix protein with possible functions in cell-matrix interactions and matrix assembly. The protein is found in various tissues and many of its tyrosine residues are sulphated. Dermatopontin is postulated to modify the be

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs748718975	G>A	Pathogenic	Coding sequence variant, missense variant

Show/Hide all(127)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019412	hsa-miR-148b-3p	Microarray	17612493
MIRT944407	hsa-miR-1184	CLIP-seq
MIRT944408	hsa-miR-1205	CLIP-seq
MIRT944409	hsa-miR-1298	CLIP-seq
MIRT944410	hsa-miR-1909	CLIP-seq
MIRT944411	hsa-miR-19a	CLIP-seq
MIRT944412	hsa-miR-19b	CLIP-seq
MIRT944413	hsa-miR-3158-5p	CLIP-seq
MIRT944414	hsa-miR-3650	CLIP-seq
MIRT944415	hsa-miR-4481	CLIP-seq
MIRT944416	hsa-miR-4491	CLIP-seq
MIRT944417	hsa-miR-4657	CLIP-seq
MIRT944418	hsa-miR-4708-3p	CLIP-seq
MIRT944419	hsa-miR-4745-5p	CLIP-seq
MIRT944420	hsa-miR-4747-5p	CLIP-seq
MIRT944421	hsa-miR-4786-3p	CLIP-seq
MIRT944422	hsa-miR-544	CLIP-seq
MIRT944423	hsa-miR-671-5p	CLIP-seq
MIRT944410	hsa-miR-1909	CLIP-seq
MIRT944411	hsa-miR-19a	CLIP-seq
MIRT944412	hsa-miR-19b	CLIP-seq
MIRT1979639	hsa-miR-2964a-5p	CLIP-seq
MIRT944414	hsa-miR-3650	CLIP-seq
MIRT1979640	hsa-miR-3667-3p	CLIP-seq
MIRT944415	hsa-miR-4481	CLIP-seq
MIRT1979641	hsa-miR-4639-5p	CLIP-seq
MIRT944418	hsa-miR-4708-3p	CLIP-seq
MIRT944419	hsa-miR-4745-5p	CLIP-seq
MIRT944421	hsa-miR-4786-3p	CLIP-seq
MIRT1979642	hsa-miR-500a	CLIP-seq
MIRT944423	hsa-miR-671-5p	CLIP-seq
MIRT1979643	hsa-miR-873	CLIP-seq
MIRT1979644	hsa-miR-890	CLIP-seq
MIRT2214716	hsa-miR-1252	CLIP-seq
MIRT2214717	hsa-miR-3692	CLIP-seq
MIRT2214718	hsa-miR-4436b-5p	CLIP-seq
MIRT1979641	hsa-miR-4639-5p	CLIP-seq
MIRT1979644	hsa-miR-890	CLIP-seq
MIRT2387102	hsa-miR-2115	CLIP-seq
MIRT2387103	hsa-miR-502-5p	CLIP-seq
MIRT2387104	hsa-miR-516a-3p	CLIP-seq
MIRT2436884	hsa-miR-2355-5p	CLIP-seq
MIRT2436885	hsa-miR-3679-3p	CLIP-seq
MIRT2436886	hsa-miR-5096	CLIP-seq
MIRT2214716	hsa-miR-1252	CLIP-seq
MIRT2519163	hsa-miR-1256	CLIP-seq
MIRT2519164	hsa-miR-1266	CLIP-seq
MIRT2519165	hsa-miR-15a	CLIP-seq
MIRT2519166	hsa-miR-15b	CLIP-seq
MIRT2519167	hsa-miR-16	CLIP-seq
MIRT2519168	hsa-miR-195	CLIP-seq
MIRT2387102	hsa-miR-2115	CLIP-seq
MIRT2519169	hsa-miR-2278	CLIP-seq
MIRT2214717	hsa-miR-3692	CLIP-seq
MIRT2519170	hsa-miR-3921	CLIP-seq
MIRT2519171	hsa-miR-3923	CLIP-seq
MIRT2519172	hsa-miR-424	CLIP-seq
MIRT2519173	hsa-miR-4256	CLIP-seq
MIRT2519174	hsa-miR-4267	CLIP-seq
MIRT2519175	hsa-miR-4270	CLIP-seq
MIRT2519176	hsa-miR-4286	CLIP-seq
MIRT2519177	hsa-miR-4311	CLIP-seq
MIRT2519178	hsa-miR-4427	CLIP-seq
MIRT2519179	hsa-miR-4434	CLIP-seq
MIRT2214718	hsa-miR-4436b-5p	CLIP-seq
MIRT2519180	hsa-miR-4441	CLIP-seq
MIRT2519181	hsa-miR-4516	CLIP-seq
MIRT2519182	hsa-miR-4518	CLIP-seq
MIRT2519183	hsa-miR-4639-3p	CLIP-seq
MIRT2519184	hsa-miR-4642	CLIP-seq
MIRT2519185	hsa-miR-4653-5p	CLIP-seq
MIRT2519186	hsa-miR-4680-3p	CLIP-seq
MIRT2519187	hsa-miR-4714-3p	CLIP-seq
MIRT2519188	hsa-miR-4715-5p	CLIP-seq
MIRT2519189	hsa-miR-490-3p	CLIP-seq
MIRT2519190	hsa-miR-497	CLIP-seq
MIRT2387103	hsa-miR-502-5p	CLIP-seq
MIRT2387104	hsa-miR-516a-3p	CLIP-seq
MIRT2519191	hsa-miR-591	CLIP-seq
MIRT2519192	hsa-miR-634	CLIP-seq
MIRT2519193	hsa-miR-668	CLIP-seq
MIRT2519194	hsa-miR-922	CLIP-seq
MIRT2519195	hsa-miR-935	CLIP-seq
MIRT2214716	hsa-miR-1252	CLIP-seq
MIRT2519163	hsa-miR-1256	CLIP-seq
MIRT2519164	hsa-miR-1266	CLIP-seq
MIRT2519165	hsa-miR-15a	CLIP-seq
MIRT2519166	hsa-miR-15b	CLIP-seq
MIRT2519167	hsa-miR-16	CLIP-seq
MIRT2519168	hsa-miR-195	CLIP-seq
MIRT2387102	hsa-miR-2115	CLIP-seq
MIRT2679457	hsa-miR-216a	CLIP-seq
MIRT2679458	hsa-miR-216b	CLIP-seq
MIRT2519169	hsa-miR-2278	CLIP-seq
MIRT2679459	hsa-miR-3143	CLIP-seq
MIRT2214717	hsa-miR-3692	CLIP-seq
MIRT2519170	hsa-miR-3921	CLIP-seq
MIRT2519171	hsa-miR-3923	CLIP-seq
MIRT2519172	hsa-miR-424	CLIP-seq
MIRT2519173	hsa-miR-4256	CLIP-seq
MIRT2519174	hsa-miR-4267	CLIP-seq
MIRT2519175	hsa-miR-4270	CLIP-seq
MIRT2519176	hsa-miR-4286	CLIP-seq
MIRT2519177	hsa-miR-4311	CLIP-seq
MIRT2519178	hsa-miR-4427	CLIP-seq
MIRT2519179	hsa-miR-4434	CLIP-seq
MIRT2214718	hsa-miR-4436b-5p	CLIP-seq
MIRT2519180	hsa-miR-4441	CLIP-seq
MIRT2519181	hsa-miR-4516	CLIP-seq
MIRT2519182	hsa-miR-4518	CLIP-seq
MIRT2519183	hsa-miR-4639-3p	CLIP-seq
MIRT2519184	hsa-miR-4642	CLIP-seq
MIRT2519185	hsa-miR-4653-5p	CLIP-seq
MIRT2519186	hsa-miR-4680-3p	CLIP-seq
MIRT2679460	hsa-miR-4683	CLIP-seq
MIRT2519187	hsa-miR-4714-3p	CLIP-seq
MIRT2519188	hsa-miR-4715-5p	CLIP-seq
MIRT2679461	hsa-miR-4803	CLIP-seq
MIRT2519189	hsa-miR-490-3p	CLIP-seq
MIRT2519190	hsa-miR-497	CLIP-seq
MIRT2387103	hsa-miR-502-5p	CLIP-seq
MIRT2387104	hsa-miR-516a-3p	CLIP-seq
MIRT2519191	hsa-miR-591	CLIP-seq
MIRT2519192	hsa-miR-634	CLIP-seq
MIRT2519193	hsa-miR-668	CLIP-seq
MIRT2519194	hsa-miR-922	CLIP-seq
MIRT2519195	hsa-miR-935	CLIP-seq

Show/Hide all(10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005201	Function	Extracellular matrix structural constituent	ISS
GO:0005201	Function	Extracellular matrix structural constituent	RCA	20551380, 25037231, 27068509, 27559042, 28675934
GO:0005515	Function	Protein binding	IPI	30082873
GO:0005615	Component	Extracellular space	HDA	20551380
GO:0007155	Process	Cell adhesion	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0030199	Process	Collagen fibril organization	IBA	21873635
GO:0062023	Component	Collagen-containing extracellular matrix	HDA	25037231, 27068509, 27559042, 28675934
GO:0062023	Component	Collagen-containing extracellular matrix	HDA	20551380
GO:0062023	Component	Collagen-containing extracellular matrix	ISS	22261194

MIM	HGNC	e!Ensembl
125597	3011	ENSG00000143196

Protein

UniProt ID

Q07507

Protein name

Dermatopontin (Tyrosine-rich acidic matrix protein) (TRAMP)

Protein function

Seems to mediate adhesion by cell surface integrin binding. May serve as a communication link between the dermal fibroblast cell surface and its extracellular matrix environment. Enhances TGFB1 activity. Inhibits cell proliferation. Accelerates

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14704	DERM	40 → 196	Dermatopontin	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in fibroblasts, heart, skeletal muscle, brain and pancreas. Expressed at an intermediate level in lung and kidney, and at a low level in liver and placenta. Expressed at a lower level in fibroblasts from hypertrophic scar les

Sequence

MDLSLLWVLLPLVTMAWGQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVR
SIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYF
ESVLDREWQFYCCRYSKRCPYSCWLTTEYPGHYGEEMDMISYNYDYYIRGATTTFSAVER
DRQWKFIMCRMTEYDCEFANV

Sequence length

201

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Restless Legs Syndrome	Restless Legs Syndrome			GWAS

Show/Hide Text Mining Associations (30)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	26683690
Adenoma	Associate	24516561
Atrial Fibrillation	Associate	23593175
Breast Neoplasms	Associate	35819135, 36774339, 39379897
Carcinogenesis	Associate	39379897
Cholangiocarcinoma	Associate	38300311
Colorectal Neoplasms	Associate	24516561, 36012487
Erythema elevatum diutinum	Stimulate	36012487
Fibrocartilaginous embolism	Associate	33536009
Fibrosis	Associate	35159124
Glucocorticoid Receptor Deficiency	Stimulate	20555348
Inflammation	Stimulate	36012487
Inflammation	Associate	38221616
Intervertebral Disc Degeneration	Associate	33536009
Keloid	Inhibit	15139000
Keloid	Associate	20555348
Leiomyoma	Inhibit	15139000, 17222838
Leiomyoma	Associate	26776909, 29747655
Leiomyosarcoma	Associate	34321013
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	38221616
Liver Cirrhosis	Associate	35159124
Lymphatic Metastasis	Associate	38300311
Meniere Disease	Associate	27876815
Neoplasm Metastasis	Associate	36774339
Neoplasms	Associate	36774339, 38300311
Obesity	Stimulate	36012487
Osteoarthritis Hip	Associate	29944724
Ovarian Neoplasms	Associate	36189254
Peritoneal Fibrosis	Stimulate	28673451
Stomach Neoplasms	Associate	34686626

DPT (dermatopontin)