Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1803
Gene name	Dipeptidyl peptidase 4
Gene symbol	DPP4
Synonyms (NCBI Gene)	ADABPADCP2CD26DPPIVTP103
Chromosome	2
Chromosome location	2q24.2
Summary	The DPP4 gene encodes dipeptidyl peptidase 4, which is identical to adenosine deaminase complexing protein-2, and to the T-cell activation antigen CD26. It is an intrinsic type II transmembrane glycoprotein and a serine exopeptidase that cleaves X-proline

190

Show/Hide all (190)

miRTarBase ID	miRNA	Experiments	Reference
MIRT755410	hsa-let-7b-5p	qRT-PCR	36073344
MIRT944211	hsa-miR-1273g	CLIP-seq
MIRT944212	hsa-miR-1305	CLIP-seq
MIRT944213	hsa-miR-4294	CLIP-seq
MIRT944214	hsa-miR-924	CLIP-seq
MIRT944211	hsa-miR-1273g	CLIP-seq
MIRT1979585	hsa-miR-1289	CLIP-seq
MIRT944212	hsa-miR-1305	CLIP-seq
MIRT1979586	hsa-miR-3198	CLIP-seq
MIRT944213	hsa-miR-4294	CLIP-seq
MIRT1979587	hsa-miR-4309	CLIP-seq
MIRT944214	hsa-miR-924	CLIP-seq
MIRT2436875	hsa-miR-2861	CLIP-seq
MIRT2436876	hsa-miR-3193	CLIP-seq
MIRT2436877	hsa-miR-34a	CLIP-seq
MIRT2436878	hsa-miR-34c-5p	CLIP-seq
MIRT2436879	hsa-miR-4488	CLIP-seq
MIRT2436880	hsa-miR-449a	CLIP-seq
MIRT2436881	hsa-miR-449b	CLIP-seq
MIRT2436882	hsa-miR-4697-5p	CLIP-seq
MIRT2436883	hsa-miR-637	CLIP-seq
MIRT2519073	hsa-miR-1200	CLIP-seq
MIRT2519074	hsa-miR-1227	CLIP-seq
MIRT2519075	hsa-miR-1269	CLIP-seq
MIRT2519076	hsa-miR-1269b	CLIP-seq
MIRT944211	hsa-miR-1273g	CLIP-seq
MIRT1979585	hsa-miR-1289	CLIP-seq
MIRT944212	hsa-miR-1305	CLIP-seq
MIRT2519077	hsa-miR-146b-3p	CLIP-seq
MIRT2519078	hsa-miR-148a	CLIP-seq
MIRT2519079	hsa-miR-148b	CLIP-seq
MIRT2519080	hsa-miR-152	CLIP-seq
MIRT2519081	hsa-miR-153	CLIP-seq
MIRT2519082	hsa-miR-186	CLIP-seq
MIRT2519083	hsa-miR-188-5p	CLIP-seq
MIRT2519084	hsa-miR-204	CLIP-seq
MIRT2519085	hsa-miR-2052	CLIP-seq
MIRT2519086	hsa-miR-211	CLIP-seq
MIRT2519087	hsa-miR-22	CLIP-seq
MIRT2519088	hsa-miR-23a	CLIP-seq
MIRT2519089	hsa-miR-23b	CLIP-seq
MIRT2519090	hsa-miR-23c	CLIP-seq
MIRT2436875	hsa-miR-2861	CLIP-seq
MIRT2519091	hsa-miR-3074-5p	CLIP-seq
MIRT2519092	hsa-miR-3133	CLIP-seq
MIRT2519093	hsa-miR-3157-3p	CLIP-seq
MIRT2519094	hsa-miR-3160-5p	CLIP-seq
MIRT2519095	hsa-miR-3173-5p	CLIP-seq
MIRT2436876	hsa-miR-3193	CLIP-seq
MIRT1979586	hsa-miR-3198	CLIP-seq
MIRT2436877	hsa-miR-34a	CLIP-seq
MIRT2436878	hsa-miR-34c-5p	CLIP-seq
MIRT2519096	hsa-miR-3646	CLIP-seq
MIRT2519097	hsa-miR-3662	CLIP-seq
MIRT2519098	hsa-miR-3672	CLIP-seq
MIRT2519099	hsa-miR-3676	CLIP-seq
MIRT2519100	hsa-miR-3913-3p	CLIP-seq
MIRT2519101	hsa-miR-3914	CLIP-seq
MIRT2519102	hsa-miR-3940-5p	CLIP-seq
MIRT2519103	hsa-miR-4264	CLIP-seq
MIRT2519104	hsa-miR-4287	CLIP-seq
MIRT2519105	hsa-miR-4293	CLIP-seq
MIRT944213	hsa-miR-4294	CLIP-seq
MIRT1979587	hsa-miR-4309	CLIP-seq
MIRT2519106	hsa-miR-4324	CLIP-seq
MIRT2519107	hsa-miR-4328	CLIP-seq
MIRT2519108	hsa-miR-4329	CLIP-seq
MIRT2519109	hsa-miR-4330	CLIP-seq
MIRT2519110	hsa-miR-4421	CLIP-seq
MIRT2519111	hsa-miR-4446-5p	CLIP-seq
MIRT2519112	hsa-miR-4469	CLIP-seq
MIRT2519113	hsa-miR-448	CLIP-seq
MIRT2436879	hsa-miR-4488	CLIP-seq
MIRT2436880	hsa-miR-449a	CLIP-seq
MIRT2436881	hsa-miR-449b	CLIP-seq
MIRT2519114	hsa-miR-4507	CLIP-seq
MIRT2519115	hsa-miR-452	CLIP-seq
MIRT2519116	hsa-miR-4529-3p	CLIP-seq
MIRT2519117	hsa-miR-4645-3p	CLIP-seq
MIRT2519118	hsa-miR-4659a-5p	CLIP-seq
MIRT2519119	hsa-miR-4659b-5p	CLIP-seq
MIRT2519120	hsa-miR-4676-3p	CLIP-seq
MIRT2519121	hsa-miR-4685-3p	CLIP-seq
MIRT2519122	hsa-miR-4697-3p	CLIP-seq
MIRT2436882	hsa-miR-4697-5p	CLIP-seq
MIRT2519123	hsa-miR-4755-5p	CLIP-seq
MIRT2519124	hsa-miR-4768-5p	CLIP-seq
MIRT2519125	hsa-miR-4776-3p	CLIP-seq
MIRT2519126	hsa-miR-4797-3p	CLIP-seq
MIRT2519127	hsa-miR-489	CLIP-seq
MIRT2519128	hsa-miR-498	CLIP-seq
MIRT2519129	hsa-miR-499-3p	CLIP-seq
MIRT2519130	hsa-miR-499a-3p	CLIP-seq
MIRT2519131	hsa-miR-520f	CLIP-seq
MIRT2519132	hsa-miR-544b	CLIP-seq
MIRT2519133	hsa-miR-548a-3p	CLIP-seq
MIRT2519134	hsa-miR-548e	CLIP-seq
MIRT2519135	hsa-miR-548f	CLIP-seq
MIRT2519136	hsa-miR-548g	CLIP-seq
MIRT2519137	hsa-miR-570	CLIP-seq
MIRT2519138	hsa-miR-596	CLIP-seq
MIRT2519139	hsa-miR-622	CLIP-seq
MIRT2519140	hsa-miR-623	CLIP-seq
MIRT2436883	hsa-miR-637	CLIP-seq
MIRT2519141	hsa-miR-642a	CLIP-seq
MIRT2519142	hsa-miR-874	CLIP-seq
MIRT2519143	hsa-miR-888	CLIP-seq
MIRT2519144	hsa-miR-9	CLIP-seq
MIRT944214	hsa-miR-924	CLIP-seq
MIRT2519145	hsa-miR-942	CLIP-seq
MIRT2519073	hsa-miR-1200	CLIP-seq
MIRT2519075	hsa-miR-1269	CLIP-seq
MIRT2519076	hsa-miR-1269b	CLIP-seq
MIRT944211	hsa-miR-1273g	CLIP-seq
MIRT1979585	hsa-miR-1289	CLIP-seq
MIRT944212	hsa-miR-1305	CLIP-seq
MIRT2519077	hsa-miR-146b-3p	CLIP-seq
MIRT2519078	hsa-miR-148a	CLIP-seq
MIRT2519079	hsa-miR-148b	CLIP-seq
MIRT2519080	hsa-miR-152	CLIP-seq
MIRT2519081	hsa-miR-153	CLIP-seq
MIRT2519084	hsa-miR-204	CLIP-seq
MIRT2519085	hsa-miR-2052	CLIP-seq
MIRT2519086	hsa-miR-211	CLIP-seq
MIRT2519087	hsa-miR-22	CLIP-seq
MIRT2519088	hsa-miR-23a	CLIP-seq
MIRT2519089	hsa-miR-23b	CLIP-seq
MIRT2519090	hsa-miR-23c	CLIP-seq
MIRT2436875	hsa-miR-2861	CLIP-seq
MIRT2519091	hsa-miR-3074-5p	CLIP-seq
MIRT2519093	hsa-miR-3157-3p	CLIP-seq
MIRT2519094	hsa-miR-3160-5p	CLIP-seq
MIRT2519095	hsa-miR-3173-5p	CLIP-seq
MIRT2436876	hsa-miR-3193	CLIP-seq
MIRT1979586	hsa-miR-3198	CLIP-seq
MIRT2436877	hsa-miR-34a	CLIP-seq
MIRT2436878	hsa-miR-34c-5p	CLIP-seq
MIRT2679443	hsa-miR-3622b-5p	CLIP-seq
MIRT2519097	hsa-miR-3662	CLIP-seq
MIRT2519098	hsa-miR-3672	CLIP-seq
MIRT2519099	hsa-miR-3676	CLIP-seq
MIRT2519100	hsa-miR-3913-3p	CLIP-seq
MIRT2519101	hsa-miR-3914	CLIP-seq
MIRT2519102	hsa-miR-3940-5p	CLIP-seq
MIRT2519103	hsa-miR-4264	CLIP-seq
MIRT2519104	hsa-miR-4287	CLIP-seq
MIRT2519105	hsa-miR-4293	CLIP-seq
MIRT944213	hsa-miR-4294	CLIP-seq
MIRT1979587	hsa-miR-4309	CLIP-seq
MIRT2519106	hsa-miR-4324	CLIP-seq
MIRT2519107	hsa-miR-4328	CLIP-seq
MIRT2519109	hsa-miR-4330	CLIP-seq
MIRT2519110	hsa-miR-4421	CLIP-seq
MIRT2519111	hsa-miR-4446-5p	CLIP-seq
MIRT2519112	hsa-miR-4469	CLIP-seq
MIRT2519113	hsa-miR-448	CLIP-seq
MIRT2436879	hsa-miR-4488	CLIP-seq
MIRT2436880	hsa-miR-449a	CLIP-seq
MIRT2436881	hsa-miR-449b	CLIP-seq
MIRT2519114	hsa-miR-4507	CLIP-seq
MIRT2519115	hsa-miR-452	CLIP-seq
MIRT2519116	hsa-miR-4529-3p	CLIP-seq
MIRT2519117	hsa-miR-4645-3p	CLIP-seq
MIRT2519118	hsa-miR-4659a-5p	CLIP-seq
MIRT2519119	hsa-miR-4659b-5p	CLIP-seq
MIRT2519120	hsa-miR-4676-3p	CLIP-seq
MIRT2519121	hsa-miR-4685-3p	CLIP-seq
MIRT2679444	hsa-miR-4694-3p	CLIP-seq
MIRT2519122	hsa-miR-4697-3p	CLIP-seq
MIRT2436882	hsa-miR-4697-5p	CLIP-seq
MIRT2519123	hsa-miR-4755-5p	CLIP-seq
MIRT2519124	hsa-miR-4768-5p	CLIP-seq
MIRT2519125	hsa-miR-4776-3p	CLIP-seq
MIRT2519126	hsa-miR-4797-3p	CLIP-seq
MIRT2519127	hsa-miR-489	CLIP-seq
MIRT2519128	hsa-miR-498	CLIP-seq
MIRT2519129	hsa-miR-499-3p	CLIP-seq
MIRT2519130	hsa-miR-499a-3p	CLIP-seq
MIRT2519131	hsa-miR-520f	CLIP-seq
MIRT2679445	hsa-miR-522	CLIP-seq
MIRT2519132	hsa-miR-544b	CLIP-seq
MIRT2519137	hsa-miR-570	CLIP-seq
MIRT2519138	hsa-miR-596	CLIP-seq
MIRT2519140	hsa-miR-623	CLIP-seq
MIRT2436883	hsa-miR-637	CLIP-seq
MIRT2519141	hsa-miR-642a	CLIP-seq
MIRT2519142	hsa-miR-874	CLIP-seq
MIRT2519144	hsa-miR-9	CLIP-seq
MIRT944214	hsa-miR-924	CLIP-seq
MIRT2519145	hsa-miR-942	CLIP-seq

Show/Hide all (61)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001618	Function	Virus receptor activity	IDA	23486063
GO:0001662	Process	Behavioral fear response	IEA
GO:0001666	Process	Response to hypoxia	IDA	16670267
GO:0002020	Function	Protease binding	IPI	16651416
GO:0004177	Function	Aminopeptidase activity	IEA
GO:0004252	Function	Serine-type endopeptidase activity	EXP	8100523, 8798518
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0005102	Function	Signaling receptor binding	IPI	10900005
GO:0005515	Function	Protein binding	IPI	7594462, 8101391, 14684150, 17287217, 17549790, 18275857, 21314817, 22001206, 23486063, 23831647, 23835475, 25461530, 29669833, 32203189, 32275855, 34903715
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005765	Component	Lysosomal membrane	HDA	17897319
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	16670267
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IDA	27198182
GO:0006508	Process	Proteolysis	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IDA	14684150
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0008239	Function	Dipeptidyl-peptidase activity	IBA
GO:0008239	Function	Dipeptidyl-peptidase activity	IDA	10593948, 14684150, 16651416, 17549790, 27198182
GO:0008239	Function	Dipeptidyl-peptidase activity	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	17549790
GO:0009986	Component	Cell surface	IDA	7594462, 8101391, 10900005, 11772392
GO:0010716	Process	Negative regulation of extracellular matrix disassembly	IDA	16651416
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IDA	15052268
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016486	Process	Peptide hormone processing	TAS
GO:0016787	Function	Hydrolase activity	IEA
GO:0019065	Process	Receptor-mediated endocytosis of virus by host cell	NAS	23831647, 32203189
GO:0030027	Component	Lamellipodium	IDA	16651416
GO:0030139	Component	Endocytic vesicle	IDA	10900005
GO:0031258	Component	Lamellipodium membrane	IEA
GO:0031295	Process	T cell costimulation	IDA	10900005, 17287217
GO:0033632	Process	Regulation of cell-cell adhesion mediated by integrin	IDA	11772392
GO:0035641	Process	Locomotory exploration behavior	IEA
GO:0036343	Process	Psychomotor behavior	IEA
GO:0042110	Process	T cell activation	IDA	7594462
GO:0042802	Function	Identical protein binding	IPI	22001206
GO:0042803	Function	Protein homodimerization activity	IPI	14684150, 15448155
GO:0042995	Component	Cell projection	IEA
GO:0043542	Process	Endothelial cell migration	IDA	16651416
GO:0045121	Component	Membrane raft	IEA
GO:0045499	Function	Chemorepellent activity	IDA	23677473
GO:0045499	Function	Chemorepellent activity	IMP	23677473
GO:0046581	Component	Intercellular canaliculus	IEA
GO:0046718	Process	Symbiont entry into host cell	NAS	23831647, 32203189
GO:0046813	Process	Receptor-mediated virion attachment to host cell	NAS	23831647, 32203189
GO:0050919	Process	Negative chemotaxis	IEA
GO:0061025	Process	Membrane fusion	NAS	23831647, 32203189
GO:0070062	Component	Extracellular exosome	HDA	11487543, 19056867, 19199708, 20458337, 21362503, 23533145
GO:0070161	Component	Anchoring junction	IEA
GO:0090024	Process	Negative regulation of neutrophil chemotaxis	IMP	23677473
GO:0120116	Process	Glucagon processing	TAS

MIM	HGNC	e!Ensembl
102720	3009	ENSG00000197635

P27487

Protein name

Dipeptidyl peptidase 4 (EC 3.4.14.5) (ADABP) (Adenosine deaminase complexing protein 2) (ADCP-2) (Dipeptidyl peptidase IV) (DPP IV) (T-cell activation antigen CD26) (TP103) (CD antigen CD26) [Cleaved into: Dipeptidyl peptidase 4 membrane form (Dipeptidyl

Protein function

Cell surface glycoprotein receptor involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation (PubMed:10900005, PubMed:10951221, PubMed:11772392, PubMed:17287217). Acts as a positive regulator of T-cell c

PDB

1J2E , 1N1M , 1NU6 , 1NU8 , 1PFQ , 1R9M , 1R9N , 1RWQ , 1TK3 , 1TKR , 1U8E , 1W1I , 1WCY , 1X70 , 2AJL , 2BGN , 2BGR , 2BUB , 2FJP , 2G5P , 2G5T , 2G63 , 2HHA , 2I03 , 2I78 , 2IIT , 2IIV , 2JID , 2OAG , 2OGZ , 2OLE , 2ONC , 2OPH , 2OQI , 2OQV , 2P8S , 2QJR , 2QKY , 2QOE , 2QT9 , 2QTB , 2RGU , 2RIP , 3BJM , 3C43 , 3C45 , 3CCB , 3CCC , 3D4L , 3EIO , 3F8S

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00930	DPPIV_N	108 → 479	Dipeptidyl peptidase IV (DPP IV) N-terminal region	Family
PF00326	Peptidase_S9	559 → 765	Prolyl oligopeptidase family	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed specifically in lymphatic vessels but not in blood vessels in the skin, small intestine, esophagus, ovary, breast and prostate glands. Not detected in lymphatic vessels in the lung, kidney, uterus, liver and stomach (at prote

Sequence

MKTPWKVLLGLLGAAALVTIITVPVVLLNKGTDDATADSRKTYTLTDYLKNTYRLKLYSL
RWISDHEYLYKQENNILVFNAEYGNSSVFLENSTFDEFGHSINDYSISPDGQFILLEYNY
VKQWRHSYTASYDIYDLNKRQLITEERIPNNTQWVTWSPVGHKLAYVWNNDIYVKIEPNL
PSYRITWTGKEDIIYNGITDWVYEEEVFSAYSALWWSPNGTFLAYAQFNDTEVPLIEYSF
YSDESLQYPKTVRVPYPKAGAVNPTVKFFVVNTDSLSSVTNATSIQITAPASMLIGDHYL
CDVTWATQERISLQWLRRIQNYSVMDICDYDESSGRWNCLVARQHIEMSTTGWVGRFRPS
EPHFTLDGNSFYKIISNEEGYRHICYFQIDKKDCTFITKGTWEVIGIEALTSDYLYYISN
EYKGMPGGRNLYKIQLSDYTKVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPGLPLY
TLHSSVNDKGLRVLEDNSALDKMLQNVQMPSKKLDFIILNETKFWYQMILPPHFDKSKKY
PLLLDVYAGPCSQKADTVFRLNWATYLASTENIIVASFDGRGSGYQGDKIMHAINRRLGT
FEVEDQIEAARQFSKMGFVDNKRIAIWGWSYGGYVTSMVLGSGSGVFKCGIAVAPVSRWE
YYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQSAQIS
KALVDVGVDFQAMWYTDEDHGIASSTAHQHIYTHMSHFIKQCFSLP

Sequence length

766

Interactions

View interactions

	KEGG		Reactome
	Virion - Hepatitis viruses Protein digestion and absorption		Synthesis, secretion, and inactivation of Glucagon-like Peptide-1 (GLP-1) Synthesis, secretion, and inactivation of Glucose-dependent Insulinotropic Polypeptide (GIP)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Clear cell carcinoma of kidney	Benign	rs17848910	RCV005902423
Colorectal cancer	Benign	rs17848910	RCV005902424
Hereditary angioedema with normal C1Inh	not provided	rs1576056789	RCV001027416

Show/Hide Text Mining Associations (224)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
3 Hydroxy 3 Methylglutaryl CoA Lyase Deficiency	Associate	18362907
Acne Vulgaris	Associate	16778789
Acute Disease	Associate	34334382
Adenocarcinoma	Associate	31992267, 36799191
Adenocarcinoma Follicular	Associate	21412686
Adenocarcinoma of Lung	Associate	35733175, 36799191
Adenoma	Associate	32051696
Albuminuria	Associate	34697593
Alzheimer Disease	Associate	32803865
Anemia Hemolytic	Associate	31399060
Aneurysm	Associate	31971988
Angioedema	Associate	18025295
Anorexia Nervosa	Associate	10564557
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis	Associate	28916770
Aortic Aneurysm Abdominal	Associate	31971988
Arthritis Rheumatoid	Associate	26177310
Arthritis Rheumatoid	Inhibit	26353808
Asthma	Associate	26975422, 29297467
Asthma	Inhibit	31101830
Ataxia Telangiectasia	Associate	32166899
Atherosclerosis	Inhibit	27771154
Atherosclerosis	Associate	33030314, 40249657
Autism Spectrum Disorder	Associate	28358038, 34947986
Autistic Disorder	Associate	14611720
Autoimmune Diseases	Associate	12414758, 12423308, 26353808, 34220840
Autoimmune Diseases	Inhibit	16778789, 35903860
Barrett Esophagus	Associate	21829465
beta Thalassemia	Associate	26715484, 27228385, 28125089, 31399060, 34752669, 37601204, 37876062
Bipolar Disorder	Associate	34947986
Bone Neoplasms	Associate	24821427
Breast Neoplasms	Associate	14633992, 22791584, 29498809, 31991851
Breast Neoplasms	Inhibit	31140748
Carcinogenesis	Associate	16611738, 28545226, 38505912
Carcinoma Giant Cell	Associate	19817894
Carcinoma Hepatocellular	Associate	19861515, 38022651
Carcinoma Papillary Follicular	Associate	32879160
Carcinoma Renal Cell	Associate	23019229, 34370716, 36799191, 37563650, 7743667, 9486416
Carcinoma Renal Cell	Stimulate	7829125
Carcinoma Squamous Cell	Associate	15161003, 36799191, 9587627
Cardiovascular Diseases	Associate	32970391, 33787603
Cholestasis	Associate	30507970
Chondroblastoma	Associate	19817894
Choriocarcinoma	Associate	31955862
Chronic Disease	Associate	30846549
Cleft Palate	Associate	30714299
Cognition Disorders	Associate	22504421
Cognitive Dysfunction	Associate	32803865, 33447019
Colonic Neoplasms	Associate	15215186, 21284881, 9587627
Colorectal Neoplasms	Associate	1347043, 15215186, 16611738, 21284881, 24142639, 24870408, 25790122, 26258407, 28545226, 31124302, 32051696, 33615655, 38203779
Common Variable Immunodeficiency	Associate	23654079
Communicable Diseases	Associate	14611720
Congenital Hyperinsulinism	Associate	26339388
Contracture	Associate	30972420
Coronary Artery Disease	Associate	33030314, 33787603
Coronary Restenosis	Associate	39413436
Coronary Stenosis	Associate	33787603
Coronavirus Infections	Associate	24043791, 28118607, 29020176, 32679426, 34535662, 35059374, 36914084, 37896834
COVID 19	Associate	32199615, 32496587, 32661206, 32679426, 33151168, 33774023, 33877545, 34391936, 34535662, 34996987, 35305722, 35406799, 35580180, 35733175, 36924127, 37728586, 37896834 View all (2 more)
COVID 19	Stimulate	36073344
Crohn Disease	Associate	33704099
Cytomegalovirus Infections	Associate	34334382
Death	Associate	37666354
Dementia	Associate	22504421
Dermatitis Atopic	Associate	8615050
Dermatitis Atopic 3	Associate	31101830
Dermatitis Herpetiformis	Associate	22991566
Dermatomyositis	Associate	33655912, 34796850
Desmoid disease hereditary	Associate	19817894
Diabetes Complications	Associate	35806251
Diabetes Gestational	Associate	33188009
Diabetes Mellitus	Associate	22504421, 23674605, 25217834, 29768061, 30894647, 31124302, 32970391, 33615655, 34089377, 34952193, 34996987, 35258398, 35635037, 36197412, 36351567, 37433152 View all (1 more)
Diabetes Mellitus Type 1	Associate	21785903
Diabetes Mellitus Type 2	Associate	11012666, 17040910, 21108831, 21137020, 22167343, 23197976, 23519473, 23674605, 23984879, 26855580, 26881257, 27111895, 27771154, 27858848, 28750074 View all (11 more)
Diabetic Nephropathies	Associate	24225429
Disease	Inhibit	2223060
Drug Related Side Effects and Adverse Reactions	Associate	28982310
Dyspepsia	Associate	40142315
Endometriosis	Associate	24825423
Esophageal Neoplasms	Stimulate	36799191
Esophageal Squamous Cell Carcinoma	Associate	35899307
Fasciculation	Associate	34796850
Fatty Liver	Associate	40249657
Fatty Liver Alcoholic	Associate	18007554
Feeding and Eating Disorders	Associate	10564557
Fetal Diseases	Associate	33188009
Fibroma Ossifying	Associate	19817894
Foot Ulcer	Associate	23197976
Gastroesophageal Reflux	Associate	21829465
Gastrointestinal Diseases	Associate	30894647
Gastrointestinal Neoplasms	Associate	38505912
Gitelman Syndrome	Inhibit	34348722
Glioblastoma	Associate	28452380
Glioma	Associate	17949241
Glucose Intolerance	Associate	25938633
Graft vs Host Disease	Associate	12423308, 34334382
Graves Ophthalmopathy	Associate	36056316
Hashimoto Disease	Stimulate	37675735, 38127960
Head and Neck Neoplasms	Associate	22674411
Heart Failure	Associate	30369565, 32113627
Heart Failure	Stimulate	30369565
Hemangioma capillary infantile	Associate	39337249
Hepatitis C Chronic	Associate	26339796, 28376103
HIV Infections	Associate	11278278, 21108831, 25938633, 32946499, 34391936
Hodgkin Disease	Associate	18362907, 35111387
Hydrops Fetalis	Associate	34511175
Hyperglycemic Hyperosmolar Nonketotic Coma	Associate	22167343, 29107298
Hypoxia	Inhibit	24825423
Hypoxia	Stimulate	25217834, 26881257
Hypoxia	Associate	33143089
Hypoxia Brain	Associate	26881257
Hypoxia Brain	Stimulate	33143089
Idiopathic Noncirrhotic Portal Hypertension	Associate	30507970
Infarction	Inhibit	22167343
Infections	Associate	18657205, 32661206, 33151168
Inflammation	Associate	10569731, 24130353, 24928308, 25938633, 25957429, 27580693, 28376103, 33061298, 33704099, 34697593, 34796850, 34944016, 35645319, 37698016, 38127960
Inflammation	Stimulate	37728586
Inflammatory Bowel Diseases	Associate	19253308, 33704099, 35060938
Influenza Human	Associate	18657205, 34198852
Insulin Resistance	Associate	24130353, 35806251
Intestinal Diseases	Associate	31992267, 37868053
Ischemia	Associate	22167343
Kidney Diseases	Associate	34697593, 36799191
Kidney Failure Chronic	Inhibit	28651949
Kidney Neoplasms	Associate	20459800
Leukemia	Associate	19469710, 22398368, 27145281, 30714299, 37457737
Leukemia Large Granular Lymphocytic	Associate	12786796
Leukemia Lymphocytic Chronic B Cell	Associate	10098734, 20534982, 8541553
Leukemia Lymphoma Adult T Cell	Associate	29444188
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	23651669, 27145281, 28122740, 30714299, 32780298
Leukemia Myeloid Acute	Associate	19469710, 30846549, 37457737
Leukemia Myeloid Acute	Stimulate	36424441
Liver Cirrhosis	Associate	26339796
Lung Diseases	Associate	34944016, 37896834
Lung Injury	Associate	34944016
Lung Neoplasms	Associate	25638566, 31124302, 35650221, 38060494
Lupus Erythematosus Systemic	Inhibit	12414758
Lymphoma B Cell Marginal Zone	Associate	35686915
Lymphoma Large Cell Anaplastic	Associate	24180670
Lymphoma Non Hodgkin	Associate	8541553
Lymphoma T Cell	Associate	18727078, 19654580, 24180670, 28431200, 9511938
Lymphoma T Cell Cutaneous	Associate	16204308
Melanoma	Inhibit	10430620, 16829852
Melanoma	Associate	22398368, 22908963
Melanoma Cutaneous Malignant	Associate	36799191
Mesothelioma Malignant	Associate	32530527, 35409274
Metabolic Diseases	Associate	12529175, 24142639
Metabolic Syndrome	Associate	20847730, 21593202, 27111895, 29107298
Mouth Diseases	Associate	31829262
Mouth Neoplasms	Associate	15161003
Multiple Myeloma	Associate	37666354
Multiple Sclerosis	Associate	31829262
Myasthenia Gravis	Associate	10593570
Mycosis Fungoides	Associate	18727078, 31050147
Mycosis Fungoides	Inhibit	28533196
Myocardial Infarction	Associate	12414758
Myocardial Infarction	Inhibit	22167343
Myositis	Associate	2168821, 34796850
Myotonic Dystrophy	Inhibit	40142315
Necrosis	Associate	34796850
Neoplasm Metastasis	Associate	15215186, 16611738, 19817894, 22896658, 26338199, 27936466, 28545226, 33615655, 37116157, 7743667
Neoplasm Metastasis	Stimulate	24870408
Neoplasm Metastasis	Inhibit	37533175
Neoplasms	Associate	10098734, 11012666, 15215186, 15737208, 16611738, 16829852, 19469710, 19654580, 19759183, 19817894, 19861515, 20021671, 20459800, 21284881, 21622624 View all (30 more)
Neoplasms	Inhibit	21674250, 29481642, 31124302, 34556748
Neoplasms Adipose Tissue	Associate	28750074
Neuralgia	Associate	34947986
Nevus	Associate	16829852, 2891780
Non alcoholic Fatty Liver Disease	Associate	38115130, 40249657
Obesity	Associate	20847730, 21593202, 24130353, 26881257, 40142315
Obesity	Inhibit	36428961
Obesity Abdominal	Associate	24130353
Ovarian Neoplasms	Associate	33143089
Pain	Associate	27580693
Pain Insensitivity Congenital	Associate	34947986
Pancreatic Neoplasms	Associate	36061308, 36799191
Pemphigoid Bullous	Stimulate	30848289, 36685490
Pemphigoid Bullous	Associate	34089377, 35958564
Personality Disorders	Associate	25790122, 27936466
Personality Disorders	Inhibit	34556748
Pleural Effusion	Associate	25638566
Polycystic Ovary Syndrome	Inhibit	35477803
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Associate	19469710
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	19469710, 8541553
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	19469710
Prediabetic State	Associate	37601204
Prion Diseases	Associate	25313508
Prostate Cancer Hereditary 7	Inhibit	34556748
Prostatic Neoplasms	Associate	11284727, 20021671, 24768141, 28055971, 37533175, 40022828
Prostatic Neoplasms	Inhibit	34556748
Psoriasis	Associate	26767505, 34089377
Pulmonary Disease Chronic Obstructive	Stimulate	29020176
Purpura Thrombocytopenic Idiopathic	Associate	32337220
Respiration Disorders	Associate	32970391
Rhinitis Allergic	Stimulate	31794148
Rhinitis Atrophic	Associate	35299869
Schizophrenia	Associate	34947986
Scleroderma Systemic	Associate	8484693
Seizures	Associate	34947986
Sepsis	Associate	40613196
Severe Acute Respiratory Syndrome	Associate	34906163
Sezary Syndrome	Inhibit	16204308, 31050147
Sezary Syndrome	Associate	18727078, 20663947, 23792457, 25511143, 26930587
Signs and Symptoms Digestive	Associate	40142315
Sjogren's Syndrome	Stimulate	34220840
Skin Diseases	Associate	26930587
Soft Tissue Neoplasms	Associate	19817894
Squamous Cell Carcinoma of Head and Neck	Associate	22252752, 22252753, 31992267, 37116157
Status Asthmaticus	Associate	26975422, 31101830
Status Asthmaticus	Stimulate	29297467
Stomach Neoplasms	Associate	26471376, 36799191, 37752199, 37868053, 38505912
Telangiectasia Hereditary Hemorrhagic	Associate	34906163
Thalassemia	Associate	27228385
Thrombosis	Inhibit	22167343
Thyroid Cancer Papillary	Associate	11752453, 17914110, 32879160
Thyroid Cancer Papillary	Stimulate	37675735
Thyroid Neoplasms	Associate	27776138, 28982310, 32970391, 36281116, 36407322, 36799191
Thyroid Nodule	Associate	37675735
Thyroiditis Autoimmune	Associate	35903860
Ulcer	Associate	23197976
Urethral Neoplasms	Associate	27936466
Uterine Cervical Neoplasms	Associate	26222679
Vasculitis	Associate	28916770
Vitamin D Deficiency	Inhibit	28376103
Weight Loss	Inhibit	21593202

DPP4 (dipeptidyl peptidase 4)