DPEP1 (dipeptidase 1)

Gene

• Entrez ID: 1800
• Gene name: Dipeptidase 1
• Gene symbol: DPEP1
• Synonyms (NCBI Gene): MBD1, MDP, RDP
• Chromosome: 16
• Chromosome location: 16q24.3
• Summary: The protein encoded by this gene is a kidney membrane enzyme involved in the metabolism of glutathione and other similar proteins by dipeptide hydrolysis. The encoded protein is known to regulate leukotriene activity by catalyzing the conversion of leukot

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT943718	hsa-miR-137	CLIP-seq
MIRT943719	hsa-miR-3140-3p	CLIP-seq
MIRT943720	hsa-miR-4318	CLIP-seq
MIRT943721	hsa-miR-4693-5p	CLIP-seq
MIRT943722	hsa-miR-4767	CLIP-seq
MIRT943723	hsa-miR-892a	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 25416956
GO:0005615	Component	Extracellular space	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA	12144777
GO:0005886	Component	Plasma membrane	TAS	20031578
GO:0006508	Process	Proteolysis	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006691	Process	Leukotriene metabolic process	TAS
GO:0006749	Process	Glutathione metabolic process	TAS	20031578
GO:0006751	Process	Glutathione catabolic process	ISS
GO:0006805	Process	Xenobiotic metabolic process	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0008235	Function	Metalloexopeptidase activity	TAS	2303490
GO:0008270	Function	Zinc ion binding	IDA	12144777, 19879002
GO:0008800	Function	Beta-lactamase activity	IDA	6334084
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016999	Process	Antibiotic metabolic process	IDA	6334084, 8737157
GO:0030054	Component	Cell junction	IDA
GO:0030336	Process	Negative regulation of cell migration	IMP	20824289
GO:0030593	Process	Neutrophil chemotaxis	IEA
GO:0031225	Component	Anchored component of membrane	IEA
GO:0031528	Component	Microvillus membrane	IEA
GO:0034235	Function	GPI anchor binding	ISS
GO:0035690	Process	Cellular response to drug	IDA	20435919
GO:0043027	Function	Cysteine-type endopeptidase inhibitor activity involved in apoptotic process	IMP	20435919
GO:0043066	Process	Negative regulation of apoptotic process	IMP	20435919
GO:0043154	Process	Negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IMP	20435919
GO:0045177	Component	Apical part of cell	IDA	20824289
GO:0050667	Process	Homocysteine metabolic process	IDA	20031578
GO:0070062	Component	Extracellular exosome	HDA	11487543, 19056867, 23533145
GO:0070573	Function	Metallodipeptidase activity	IDA	12144777, 19879002
GO:0071277	Process	Cellular response to calcium ion	ISS
GO:0071732	Process	Cellular response to nitric oxide	ISS
GO:0072340	Process	Cellular lactam catabolic process	TAS	12144777
GO:0072341	Function	Modified amino acid binding	IDA	20031578

Other IDs

• MIM: 179780
• HGNC: 3002
• e!Ensembl: ENSG00000015413

Protein

• UniProt ID: P16444
• Protein name: Dipeptidase 1 (EC 3.4.13.19) (Beta-lactamase) (EC 3.5.2.6) (Dehydropeptidase-I) (Microsomal dipeptidase) (Renal dipeptidase) (hRDP)
• Protein function: Hydrolyzes a wide range of dipeptides including the conversion of leukotriene D4 to leukotriene E4 (PubMed:2303490, PubMed:31442408, PubMed:32325220, PubMed:6334084). Hydrolyzes cystinyl-bis-glycine (cys-bis-gly) formed during glutathione degrad
• PDB: 1ITQ, 1ITU
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01244	Peptidase_M19	25 → 352	Membrane dipeptidase (Peptidase family M19)	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in lung and kidneys. {ECO:0000269|PubMed:31442408, ECO:0000269|PubMed:8439558}.
• Sequence:

  MWSGWWLWPLVAVCTADFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTT
  LAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVT
  SSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLV
  DTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYS
  VCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVG
  FGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLT
  QAPEEEPIPLDQLGGSCRTHYGYSSGASSLHRHWGLLLASLAPLVLCLSLL

• Sequence length: 411

Pathways

Reactome:

Synthesis of Leukotrienes (LT) and Eoxins (EX)
Aflatoxin activation and detoxification
LTC4-CYSLTR mediated IL4 production

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Arthritis	Degenerative polyarthritis	rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470	30664745
Colorectal cancer	Colorectal Carcinoma	rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800, rs63750198, rs63751109, rs863223312, rs63750710, rs63751615, rs63750206, rs63750781, rs63750899, rs63750691, rs63750217, rs121912965, rs63749939, rs63751194, rs63750693, rs63750540, rs63751221, rs193922370, rs80359596, rs397514632, rs483352909, rs200495564, rs397514684, rs397516436, rs398122386, rs79512956, rs74953290, rs587779001, rs63750677, rs63749837, rs267607816, rs63751715, rs267607819, rs267607815, rs267607822, rs63749906, rs587778883, rs63750472, rs63751012, rs63750715, rs63750580, rs267607706, rs267607709, rs267607710, rs587778894, rs63750749, rs63750483, rs63751015, rs63751153, rs63751094, rs63751118, rs63750316, rs63749981, rs587778906, rs267607821, rs587778908, rs63750020, rs587778909, rs63750713, rs267607825, rs63751592, rs281864936, rs587778913, rs587778914, rs63749795, rs63750855, rs63749916, rs63749923, rs63751472, rs63751689, rs267607832, rs267607837, rs267607836, rs587778923, rs63750028, rs587778928, rs587778929, rs587778930, rs63751277, rs587778933, rs267607842, rs267607843, rs63750192, rs587778934, rs63750193, rs587778937, rs587778938, rs267607845, rs63751244, rs63751393, rs63751460, rs267607849, rs267607853, rs267607856, rs267607850, rs63751657, rs267607854, rs267607852, rs587778942, rs63750309, rs63750587, rs63749863, rs63751486, rs63750016, rs63749868, rs63750375, rs63750035, rs63750604, rs63750386, rs63750150, rs63750486, rs63751428, rs267607866, rs63749986, rs63751594, rs63750152, rs63750850, rs267607867, rs267607868, rs63751632, rs267607871, rs63751892, rs587778956, rs63750469, rs587778958, rs63749792, rs267607875, rs63751255, rs281864938, rs63751202, rs63750726, rs63751310, rs63749900, rs587778964, rs267607879, rs267607878, rs587778966, rs267607883, rs267607887, rs63750061, rs63750663, rs587778968, rs587778971, rs63750809, rs63749867, rs63750864, rs587778972, rs63751275, rs267607718, rs267607722, rs63750769, rs267607717, rs587778973, rs267607716, rs267607720, rs63749995, rs63750859, rs587778975, rs63750114, rs587778976, rs63750603, rs267607889, rs267607723, rs63750561, rs63750499, rs63751642, rs63751022, rs587778981, rs63750971, rs267607898, rs267607906, rs267607903, rs587778989, rs587778992, rs267607894, rs267607901, rs267607892, rs63750437, rs587778997, rs587778998, rs63750005, rs63750641, rs63751421, rs11541859, rs63750266, rs111052004, rs267607726, rs267607727, rs63750453, rs267607734, rs267607735, rs63751665, rs267607736, rs267607732, rs63749816, rs63750539, rs267607739, rs587779006, rs587779008, rs267607745, rs267607742, rs63751595, rs267607743, rs587779010, rs587779012, rs63750057, rs63749818, rs63751124, rs587779014, rs587779015, rs63749820, rs63751302, rs267607750, rs267607751, rs267607749, rs63750891, rs63749959, rs63749804, rs267607765, rs267607760, rs587779021, rs267607759, rs63750515, rs587779023, rs63751021, rs63751480, rs267607772, rs267607773, rs587779024, rs63751653, rs587779027, rs267607767, rs587779029, rs63750706, rs63750385, rs267607774, rs267607778, rs267607780, rs587779034, rs63751711, rs267607784, rs587779035, rs63750823, rs63750822, rs267607787, rs63750303, rs63749839, rs63749827, rs267607789, rs267607790, rs267607791, rs267607786, rs267607771, rs267607795, rs267607794, rs267607788, rs267607799, rs267607801, rs587779045, rs63750034, rs587779047, rs63750216, rs63751707, rs63751598, rs267607803, rs267607777, rs63750144, rs267607805, rs63750547, rs63750489, rs63750993, rs587779054, rs63751259, rs63749926, rs63750796, rs587779058, rs63750745, rs63750582, rs180177084, rs587779866, rs200389141, rs587779950, rs587780104, rs587780183, rs587778536, rs587780683, rs587781554, rs267607712, rs587777627, rs587783057, rs730881734, rs41542214, rs730881273, rs786203456, rs786201990, rs786202767, rs748005072, rs786204317, rs786204318, rs797045117, rs63750549, rs863225383, rs863225384, rs863225373, rs863225376, rs863225377, rs863225378, rs863225379, rs863225380, rs863225381, rs63750059, rs267607823, rs864622457, rs869312767, rs869312753, rs876661059, rs876658915, rs876658923, rs876660860, rs876660822, rs876660458, rs876660214, rs876658657, rs876658247, rs876659226, rs876658821, rs876660589, rs876659068, rs876659681, rs876659608, rs878853794, rs878853778, rs878853780, rs878853785, rs886039423, rs886039424, rs1057517543, rs1057517541, rs756843954, rs1057517617, rs1057517558, rs1057519256, rs1060500689, rs764085979, rs1060500707, rs1060500699, rs1060500706, rs1060500703, rs1064795341, rs1064793607, rs1064794348, rs1064795441, rs1064794373, rs1064793172, rs1064794122, rs1064795515, rs1064794331, rs63750978, rs1114167435, rs1553641362, rs63751448, rs1553648029, rs1553648058, rs587778903, rs1553653237, rs1553664353, rs267607744, rs1553647995, rs1553648047, rs1553653084, rs1553663750, rs1553664436, rs1553488015, rs1553637293, rs63750310, rs63750443, rs63751596, rs1553646681, rs550890395, rs1064796057, rs1553642079, rs1553648023, rs587782087, rs746536721, rs1553653037, rs1248251121, rs1553646602, rs1434898623, rs1553665683, rs1553648068, rs1553645331, rs1553644123, rs1553658246, rs1553651299, rs1553648149, rs1553663159, rs1302248679, rs1553664119, rs1553658009, rs1553665977, rs1416171624, rs1553663834, rs1553664617, rs1553664702, rs1553647969, rs1553648040, rs1437454428, rs1553641273, rs63751101, rs1553646764, rs1553648225, rs1554082118, rs1553648201, rs1553638868, rs1553665866, rs376736188, rs1553642707, rs1553645226, rs1553652883, rs63751435, rs1553653115, rs1553653195, rs63750300, rs1553662622, rs1553658104, rs1553648220, rs1559544064, rs63750584, rs267608083, rs1559551570, rs1559575107, rs1559553501, rs1565986506, rs1559524405, rs1559553492, rs1559554339, rs1559588540, rs1559558071, rs761329565, rs1559521039, rs1559574795, rs1567221417, rs1559578422, rs1481129490, rs1570714352, rs779783209, rs1575376830, rs1575469070, rs1575537843, rs1575620443, rs1575621506, rs587779022, rs1575414904, rs1575449093, rs1575469505, rs1575536254, rs1575537933, rs1575632112, rs1575639851, rs1575441094, rs1575449402, rs267607831, rs2081922847, rs2083403132, rs2085415927, rs2085469647, rs2043913790, rs147542208
Hypertension	Hypertensive disease	rs13306026	27618447

Unknown
Disease term	Disease name	Evidence	References	Source
Melanoma	Melanoma	SMAD3 and SLC9A5 gain?of?function increases invasion capability of melanoma cells.		GWAS, CBGDA
Hyperuricemia	Hyperuricemia			GWAS
Kidney Disease	Kidney Disease			GWAS
Diabetes	Diabetes			GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Carcinogenesis	Associate	31541079
Carcinoma Ductal	Stimulate	28410206
Carcinoma Pancreatic Ductal	Associate	22363658
Carcinoma Renal Cell	Associate	37328520
Colonic Neoplasms	Associate	39738398
Colorectal Neoplasms	Associate	21076463, 28181595, 31137244, 35670012
Crohn Disease	Associate	39738398
Hepatoblastoma	Associate	31541079
Inflammation	Stimulate	19103524
Inflammation	Associate	31432706
Kidney Tubular Necrosis Acute	Associate	35108055
Leukemia Myeloid Acute	Associate	34619772
Macular Degeneration	Inhibit	30310092
Neoplasm Metastasis	Associate	37378426
Neoplasms	Associate	21076463, 31541079
Neoplasms	Inhibit	22363658
Ovarian Diseases	Associate	21076463
Ovarian Neoplasms	Associate	21076463
Pancreatic Neoplasms	Associate	22363658
Prostatic Neoplasms	Inhibit	35789022
Prostatic Neoplasms	Associate	37378426
Renal Insufficiency Chronic	Associate	31432706
Thrombosis	Associate	37328520
Uremia	Associate	31432706