Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1800
Gene name Gene Name - the full gene name approved by the HGNC.	Dipeptidase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DPEP1
Synonyms (NCBI Gene) Gene synonyms aliases	MBD1, MDP, RDP
Chromosome Chromosome number	16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	16q24.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a kidney membrane enzyme involved in the metabolism of glutathione and other similar proteins by dipeptide hydrolysis. The encoded protein is known to regulate leukotriene activity by catalyzing the conversion of leukot

Show/Hide all(6)

miRTarBase ID	miRNA	Experiments
MIRT943718	hsa-miR-137	CLIP-seq
MIRT943719	hsa-miR-3140-3p	CLIP-seq
MIRT943720	hsa-miR-4318	CLIP-seq
MIRT943721	hsa-miR-4693-5p	CLIP-seq
MIRT943722	hsa-miR-4767	CLIP-seq
MIRT943723	hsa-miR-892a	CLIP-seq

Show/Hide all(47)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 25416956, 28514442, 33961781
GO:0005615	Component	Extracellular space	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	12144777
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	20031578
GO:0006508	Process	Proteolysis	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006691	Process	Leukotriene metabolic process	IEA
GO:0006749	Process	Glutathione metabolic process	TAS	20031578
GO:0006751	Process	Glutathione catabolic process	IEA
GO:0006751	Process	Glutathione catabolic process	ISS
GO:0006954	Process	Inflammatory response	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008235	Function	Metalloexopeptidase activity	TAS	2303490
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008270	Function	Zinc ion binding	IDA	12144777, 19879002
GO:0008800	Function	Beta-lactamase activity	IDA	6334084, 32325220
GO:0008800	Function	Beta-lactamase activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016805	Function	Dipeptidase activity	IBA
GO:0016805	Function	Dipeptidase activity	IDA	32325220
GO:0016805	Function	Dipeptidase activity	IEA
GO:0016999	Process	Antibiotic metabolic process	IDA	6334084, 8737157
GO:0016999	Process	Antibiotic metabolic process	IEA
GO:0030054	Component	Cell junction	IDA
GO:0030336	Process	Negative regulation of cell migration	IMP	20824289
GO:0030593	Process	Neutrophil chemotaxis	IEA
GO:0031528	Component	Microvillus membrane	IEA
GO:0034235	Function	GPI anchor binding	ISS
GO:0042995	Component	Cell projection	IEA
GO:0045177	Component	Apical part of cell	IDA	20824289
GO:0046872	Function	Metal ion binding	IEA
GO:0050667	Process	Homocysteine metabolic process	IDA	20031578
GO:0070062	Component	Extracellular exosome	HDA	11487543, 19056867, 23533145
GO:0070573	Function	Metallodipeptidase activity	IDA	12144777, 19879002
GO:0070573	Function	Metallodipeptidase activity	IEA
GO:0071277	Process	Cellular response to calcium ion	ISS
GO:0071732	Process	Cellular response to nitric oxide	ISS
GO:0072340	Process	Lactam catabolic process	TAS	12144777
GO:0072341	Function	Modified amino acid binding	IDA	20031578
GO:0098552	Component	Side of membrane	IEA
GO:1901749	Process	Leukotriene D4 catabolic process	IDA	32325220
GO:1901749	Process	Leukotriene D4 catabolic process	IEA

MIM	HGNC	e!Ensembl
179780	3002	ENSG00000015413

Protein

UniProt ID

P16444

Protein name

Dipeptidase 1 (EC 3.4.13.19) (Beta-lactamase) (EC 3.5.2.6) (Dehydropeptidase-I) (Microsomal dipeptidase) (Renal dipeptidase) (hRDP)

Protein function

Hydrolyzes a wide range of dipeptides including the conversion of leukotriene D4 to leukotriene E4 (PubMed:2303490, PubMed:31442408, PubMed:32325220, PubMed:6334084). Hydrolyzes cystinyl-bis-glycine (cys-bis-gly) formed during glutathione degrad

PDB

1ITQ , 1ITU

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01244	Peptidase_M19	25 → 352	Membrane dipeptidase (Peptidase family M19)	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in lung and kidneys. {ECO:0000269|PubMed:31442408, ECO:0000269|PubMed:8439558}.

Sequence

MWSGWWLWPLVAVCTADFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTT
LAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVT
SSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLV
DTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYS
VCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVG
FGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLT
QAPEEEPIPLDQLGGSCRTHYGYSSGASSLHRHWGLLLASLAPLVLCLSLL

Sequence length

411

Interactions

View interactions

	Reactome
			Synthesis of Leukotrienes (LT) and Eoxins (EX) Aflatoxin activation and detoxification LTC4-CYSLTR mediated IL4 production

Show/Hide Unknown Diseases (5)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Diabetes	Type 2 diabetes	N/A	N/A	GWAS
Hypertension	Hypertension, Hypertension (confirmatory factor analysis Factor 12)	N/A	N/A	GWAS
Hyperuricemia	Hyperuricemia	N/A	N/A	GWAS
Kidney Disease	Chronic kidney disease	N/A	N/A	GWAS
Melanoma	Melanoma	N/A	N/A	GWAS

Show/Hide Text Mining Associations (24)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Carcinogenesis	Associate	31541079
Carcinoma Ductal	Stimulate	28410206
Carcinoma Pancreatic Ductal	Associate	22363658
Carcinoma Renal Cell	Associate	37328520
Colonic Neoplasms	Associate	39738398
Colorectal Neoplasms	Associate	21076463, 28181595, 31137244, 35670012
Crohn Disease	Associate	39738398
Hepatoblastoma	Associate	31541079
Inflammation	Stimulate	19103524
Inflammation	Associate	31432706
Kidney Tubular Necrosis Acute	Associate	35108055
Leukemia Myeloid Acute	Associate	34619772
Macular Degeneration	Inhibit	30310092
Neoplasm Metastasis	Associate	37378426
Neoplasms	Associate	21076463, 31541079
Neoplasms	Inhibit	22363658
Ovarian Diseases	Associate	21076463
Ovarian Neoplasms	Associate	21076463
Pancreatic Neoplasms	Associate	22363658
Prostatic Neoplasms	Inhibit	35789022
Prostatic Neoplasms	Associate	37378426
Renal Insufficiency Chronic	Associate	31432706
Thrombosis	Associate	37328520
Uremia	Associate	31432706

DPEP1 (dipeptidase 1)