DPEP1 (dipeptidase 1)

Gene

• Entrez ID: 1800
• Gene name: Dipeptidase 1
• Gene symbol: DPEP1
• Synonyms (NCBI Gene): MBD1, MDP, RDP
• Chromosome: 16
• Chromosome location: 16q24.3
• Summary: The protein encoded by this gene is a kidney membrane enzyme involved in the metabolism of glutathione and other similar proteins by dipeptide hydrolysis. The encoded protein is known to regulate leukotriene activity by catalyzing the conversion of leukot

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT943718	hsa-miR-137	CLIP-seq
MIRT943719	hsa-miR-3140-3p	CLIP-seq
MIRT943720	hsa-miR-4318	CLIP-seq
MIRT943721	hsa-miR-4693-5p	CLIP-seq
MIRT943722	hsa-miR-4767	CLIP-seq
MIRT943723	hsa-miR-892a	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 25416956, 28514442, 33961781
GO:0005615	Component	Extracellular space	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	12144777
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	20031578
GO:0006508	Process	Proteolysis	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006691	Process	Leukotriene metabolic process	IEA
GO:0006749	Process	Glutathione metabolic process	TAS	20031578
GO:0006751	Process	Glutathione catabolic process	IEA
GO:0006751	Process	Glutathione catabolic process	ISS
GO:0006954	Process	Inflammatory response	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008235	Function	Metalloexopeptidase activity	TAS	2303490
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008270	Function	Zinc ion binding	IDA	12144777, 19879002
GO:0008800	Function	Beta-lactamase activity	IDA	6334084, 32325220
GO:0008800	Function	Beta-lactamase activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016805	Function	Dipeptidase activity	IBA
GO:0016805	Function	Dipeptidase activity	IDA	32325220
GO:0016805	Function	Dipeptidase activity	IEA
GO:0016999	Process	Antibiotic metabolic process	IDA	6334084, 8737157
GO:0016999	Process	Antibiotic metabolic process	IEA
GO:0030054	Component	Cell junction	IDA
GO:0030336	Process	Negative regulation of cell migration	IMP	20824289
GO:0030593	Process	Neutrophil chemotaxis	IEA
GO:0031528	Component	Microvillus membrane	IEA
GO:0034235	Function	GPI anchor binding	ISS
GO:0042995	Component	Cell projection	IEA
GO:0045177	Component	Apical part of cell	IDA	20824289
GO:0046872	Function	Metal ion binding	IEA
GO:0050667	Process	Homocysteine metabolic process	IDA	20031578
GO:0070062	Component	Extracellular exosome	HDA	11487543, 19056867, 23533145
GO:0070573	Function	Metallodipeptidase activity	IDA	12144777, 19879002
GO:0070573	Function	Metallodipeptidase activity	IEA
GO:0071277	Process	Cellular response to calcium ion	ISS
GO:0071732	Process	Cellular response to nitric oxide	ISS
GO:0072340	Process	Lactam catabolic process	TAS	12144777
GO:0072341	Function	Modified amino acid binding	IDA	20031578
GO:0098552	Component	Side of membrane	IEA
GO:1901749	Process	Leukotriene D4 catabolic process	IDA	32325220
GO:1901749	Process	Leukotriene D4 catabolic process	IEA

Other IDs

• MIM: 179780
• HGNC: 3002
• e!Ensembl: ENSG00000015413

Protein

• UniProt ID: P16444
• Protein name: Dipeptidase 1 (EC 3.4.13.19) (Beta-lactamase) (EC 3.5.2.6) (Dehydropeptidase-I) (Microsomal dipeptidase) (Renal dipeptidase) (hRDP)
• Protein function: Hydrolyzes a wide range of dipeptides including the conversion of leukotriene D4 to leukotriene E4 (PubMed:2303490, PubMed:31442408, PubMed:32325220, PubMed:6334084). Hydrolyzes cystinyl-bis-glycine (cys-bis-gly) formed during glutathione degrad
• PDB: 1ITQ, 1ITU
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01244	Peptidase_M19	25 → 352	Membrane dipeptidase (Peptidase family M19)	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in lung and kidneys. {ECO:0000269|PubMed:31442408, ECO:0000269|PubMed:8439558}.
• Sequence:

  MWSGWWLWPLVAVCTADFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTT
  LAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVT
  SSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLV
  DTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYS
  VCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVG
  FGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLT
  QAPEEEPIPLDQLGGSCRTHYGYSSGASSLHRHWGLLLASLAPLVLCLSLL

• Sequence length: 411

Pathways

Reactome:

Synthesis of Leukotrienes (LT) and Eoxins (EX)
Aflatoxin activation and detoxification
LTC4-CYSLTR mediated IL4 production