Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein
Entrez ID	1746
Gene name	Distal-less homeobox 2
Gene symbol	DLX2
Synonyms (NCBI Gene)	TES-1TES1
Chromosome	2
Chromosome location	2q31.1
Summary	Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed

120

Show/Hide all (120)

miRTarBase ID	miRNA	Experiments	Reference
MIRT043264	hsa-miR-331-3p	CLASH	23622248
MIRT042820	hsa-miR-324-3p	CLASH	23622248
MIRT036105	hsa-miR-1296-5p	CLASH	23622248
MIRT567747	hsa-miR-551b-5p	PAR-CLIP	20371350
MIRT567746	hsa-miR-300	PAR-CLIP	20371350
MIRT567745	hsa-miR-381-3p	PAR-CLIP	20371350
MIRT567744	hsa-miR-4666a-3p	PAR-CLIP	20371350
MIRT567743	hsa-miR-5094	PAR-CLIP	20371350
MIRT567742	hsa-miR-5693	PAR-CLIP	20371350
MIRT567741	hsa-miR-194-3p	PAR-CLIP	20371350
MIRT567740	hsa-miR-4766-5p	PAR-CLIP	20371350
MIRT567739	hsa-miR-496	PAR-CLIP	20371350
MIRT567738	hsa-let-7a-3p	PAR-CLIP	20371350
MIRT567737	hsa-let-7b-3p	PAR-CLIP	20371350
MIRT567736	hsa-let-7f-1-3p	PAR-CLIP	20371350
MIRT567735	hsa-miR-98-3p	PAR-CLIP	20371350
MIRT567734	hsa-miR-4789-5p	PAR-CLIP	20371350
MIRT567733	hsa-let-7f-2-3p	PAR-CLIP	20371350
MIRT567732	hsa-miR-1185-1-3p	PAR-CLIP	20371350
MIRT567731	hsa-miR-1185-2-3p	PAR-CLIP	20371350
MIRT494123	hsa-miR-4779	PAR-CLIP	23592263
MIRT494122	hsa-miR-6750-5p	PAR-CLIP	23592263
MIRT494121	hsa-miR-6822-5p	PAR-CLIP	23592263
MIRT494120	hsa-miR-4707-5p	PAR-CLIP	23592263
MIRT494118	hsa-miR-765	PAR-CLIP	23592263
MIRT494119	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT494117	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT494116	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT494115	hsa-miR-6781-5p	PAR-CLIP	23592263
MIRT567747	hsa-miR-551b-5p	PAR-CLIP	20371350
MIRT567746	hsa-miR-300	PAR-CLIP	20371350
MIRT567745	hsa-miR-381-3p	PAR-CLIP	20371350
MIRT567744	hsa-miR-4666a-3p	PAR-CLIP	20371350
MIRT567743	hsa-miR-5094	PAR-CLIP	20371350
MIRT567742	hsa-miR-5693	PAR-CLIP	20371350
MIRT567741	hsa-miR-194-3p	PAR-CLIP	20371350
MIRT567740	hsa-miR-4766-5p	PAR-CLIP	20371350
MIRT567739	hsa-miR-496	PAR-CLIP	20371350
MIRT567738	hsa-let-7a-3p	PAR-CLIP	20371350
MIRT567737	hsa-let-7b-3p	PAR-CLIP	20371350
MIRT567736	hsa-let-7f-1-3p	PAR-CLIP	20371350
MIRT567735	hsa-miR-98-3p	PAR-CLIP	20371350
MIRT567734	hsa-miR-4789-5p	PAR-CLIP	20371350
MIRT567733	hsa-let-7f-2-3p	PAR-CLIP	20371350
MIRT567732	hsa-miR-1185-1-3p	PAR-CLIP	20371350
MIRT567731	hsa-miR-1185-2-3p	PAR-CLIP	20371350
MIRT494123	hsa-miR-4779	PAR-CLIP	23592263
MIRT494122	hsa-miR-6750-5p	PAR-CLIP	23592263
MIRT494121	hsa-miR-6822-5p	PAR-CLIP	23592263
MIRT494120	hsa-miR-4707-5p	PAR-CLIP	23592263
MIRT494118	hsa-miR-765	PAR-CLIP	23592263
MIRT494119	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT494117	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT494116	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT494115	hsa-miR-6781-5p	PAR-CLIP	23592263
MIRT938917	hsa-miR-124	CLIP-seq
MIRT938918	hsa-miR-1305	CLIP-seq
MIRT938919	hsa-miR-199a-3p	CLIP-seq
MIRT938920	hsa-miR-199b-3p	CLIP-seq
MIRT938921	hsa-miR-203	CLIP-seq
MIRT938922	hsa-miR-21	CLIP-seq
MIRT938923	hsa-miR-299-5p	CLIP-seq
MIRT938924	hsa-miR-3129-5p	CLIP-seq
MIRT938925	hsa-miR-3613-3p	CLIP-seq
MIRT938926	hsa-miR-3662	CLIP-seq
MIRT938927	hsa-miR-4307	CLIP-seq
MIRT938928	hsa-miR-4328	CLIP-seq
MIRT938929	hsa-miR-4418	CLIP-seq
MIRT938930	hsa-miR-4663	CLIP-seq
MIRT938931	hsa-miR-4698	CLIP-seq
MIRT938932	hsa-miR-4775	CLIP-seq
MIRT938933	hsa-miR-506	CLIP-seq
MIRT938934	hsa-miR-509-3-5p	CLIP-seq
MIRT938935	hsa-miR-509-5p	CLIP-seq
MIRT938936	hsa-miR-5096	CLIP-seq
MIRT938937	hsa-miR-520d-5p	CLIP-seq
MIRT938938	hsa-miR-524-5p	CLIP-seq
MIRT938939	hsa-miR-548an	CLIP-seq
MIRT938940	hsa-miR-548g	CLIP-seq
MIRT938941	hsa-miR-590-5p	CLIP-seq
MIRT938942	hsa-miR-628-5p	CLIP-seq
MIRT938943	hsa-miR-629	CLIP-seq
MIRT938944	hsa-miR-637	CLIP-seq
MIRT938945	hsa-miR-936	CLIP-seq
MIRT938946	hsa-miR-95	CLIP-seq
MIRT1977772	hsa-miR-1292	CLIP-seq
MIRT1977773	hsa-miR-4446-3p	CLIP-seq
MIRT1977774	hsa-miR-4471	CLIP-seq
MIRT1977775	hsa-miR-4492	CLIP-seq
MIRT1977776	hsa-miR-4498	CLIP-seq
MIRT1977777	hsa-miR-4505	CLIP-seq
MIRT1977778	hsa-miR-4646-5p	CLIP-seq
MIRT1977779	hsa-miR-4721	CLIP-seq
MIRT1977780	hsa-miR-762	CLIP-seq
MIRT938926	hsa-miR-3662	CLIP-seq
MIRT938931	hsa-miR-4698	CLIP-seq
MIRT938946	hsa-miR-95	CLIP-seq
MIRT938937	hsa-miR-520d-5p	CLIP-seq
MIRT938938	hsa-miR-524-5p	CLIP-seq
MIRT2516947	hsa-miR-3657	CLIP-seq
MIRT2516948	hsa-miR-3664-5p	CLIP-seq
MIRT2516949	hsa-miR-3691-3p	CLIP-seq
MIRT2516950	hsa-miR-4645-5p	CLIP-seq
MIRT2516951	hsa-miR-4669	CLIP-seq
MIRT2516952	hsa-miR-4673	CLIP-seq
MIRT2516953	hsa-miR-4699-3p	CLIP-seq
MIRT938937	hsa-miR-520d-5p	CLIP-seq
MIRT938938	hsa-miR-524-5p	CLIP-seq
MIRT2679305	hsa-miR-3140-5p	CLIP-seq
MIRT2516947	hsa-miR-3657	CLIP-seq
MIRT2516948	hsa-miR-3664-5p	CLIP-seq
MIRT2516949	hsa-miR-3691-3p	CLIP-seq
MIRT2679306	hsa-miR-4427	CLIP-seq
MIRT2516950	hsa-miR-4645-5p	CLIP-seq
MIRT2516951	hsa-miR-4669	CLIP-seq
MIRT2516952	hsa-miR-4673	CLIP-seq
MIRT2516953	hsa-miR-4699-3p	CLIP-seq
MIRT2679307	hsa-miR-500a	CLIP-seq
MIRT938937	hsa-miR-520d-5p	CLIP-seq
MIRT938938	hsa-miR-524-5p	CLIP-seq

Show/Hide all (51)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000976	Function	Transcription cis-regulatory region binding	ISS
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	1354641
GO:0003727	Function	Single-stranded RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	25416956
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0007219	Process	Notch signaling pathway	IEA
GO:0007420	Process	Brain development	TAS	7590232
GO:0009954	Process	Proximal/distal pattern formation	IEA
GO:0014016	Process	Neuroblast differentiation	IEA
GO:0021544	Process	Subpallium development	IEA
GO:0021766	Process	Hippocampus development	IEA
GO:0021772	Process	Olfactory bulb development	IEA
GO:0021879	Process	Forebrain neuron differentiation	IEA
GO:0021892	Process	Cerebral cortex GABAergic interneuron differentiation	IEA
GO:0021893	Process	Cerebral cortex GABAergic interneuron fate commitment	IEA
GO:0030154	Process	Cell differentiation	IBA
GO:0030154	Process	Cell differentiation	IEA
GO:0042475	Process	Odontogenesis of dentin-containing tooth	IEA
GO:0045597	Process	Positive regulation of cell differentiation	IEA
GO:0045597	Process	Positive regulation of cell differentiation	ISS
GO:0045746	Process	Negative regulation of Notch signaling pathway	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046533	Process	Negative regulation of photoreceptor cell differentiation	IEA
GO:0046533	Process	Negative regulation of photoreceptor cell differentiation	ISS
GO:0048701	Process	Embryonic cranial skeleton morphogenesis	IEA
GO:0048706	Process	Embryonic skeletal system development	IBA
GO:0048706	Process	Embryonic skeletal system development	IEA
GO:0048709	Process	Oligodendrocyte differentiation	IEA
GO:0048715	Process	Negative regulation of oligodendrocyte differentiation	IEA
GO:0048755	Process	Branching morphogenesis of a nerve	IEA
GO:0051216	Process	Cartilage development	IEA
GO:0097154	Process	GABAergic neuron differentiation	IEA
GO:1902871	Process	Positive regulation of amacrine cell differentiation	IEA
GO:1902871	Process	Positive regulation of amacrine cell differentiation	ISS
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
126255	2915	ENSG00000115844

Q07687

Protein name

Homeobox protein DLX-2

Protein function

Acts as a transcriptional activator (By similarity). Activates transcription of CGA/alpha-GSU, via binding to the downstream activin regulatory element (DARE) in the gene promoter (By similarity). Plays a role in terminal differentiation of inte

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12413	DLL_N	51 → 132	Homeobox protein distal-less-like N terminal	Family
PF00046	Homeodomain	153 → 209	Homeodomain	Domain

Sequence

MTGVFDSLVADMHSTQIAASSTYHQHQQPPSGGGAGPGGNSSSSSSLHKPQESPTLPVST
ATDSSYYTNQQHPAGGGGGGGSPYAHMGSYQYQASGLNNVPYSAKSSYDLGYTAAYTSYA
PYGTSSSPANNEPEKEDLEPEIRIVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALP
ERAELAASLGLTQTQVKIWFQNRRSKFKKMWKSGEIPSEQHPGASASPPCASPPVSAPAS
WDFGVPQRMAGGGGPGSGGSGAGSSGSSPSSAASAFLGNYPWYHQTSGSASHLQATAPLL
HPTQTPQPHHHHHHHGGGGAPVSAGTIF

Sequence length

328

Interactions

View interactions

DLX2 (distal-less homeobox 2)