Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1746
Gene name Gene Name - the full gene name approved by the HGNC.	Distal-less homeobox 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DLX2
Synonyms (NCBI Gene) Gene synonyms aliases	TES-1, TES1
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q31.1
Summary Summary of gene provided in NCBI Entrez Gene.	Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed

Show/Hide all(120)

miRTarBase ID	miRNA	Experiments	Reference
MIRT043264	hsa-miR-331-3p	CLASH	23622248
MIRT042820	hsa-miR-324-3p	CLASH	23622248
MIRT036105	hsa-miR-1296-5p	CLASH	23622248
MIRT567747	hsa-miR-551b-5p	PAR-CLIP	20371350
MIRT567746	hsa-miR-300	PAR-CLIP	20371350
MIRT567745	hsa-miR-381-3p	PAR-CLIP	20371350
MIRT567744	hsa-miR-4666a-3p	PAR-CLIP	20371350
MIRT567743	hsa-miR-5094	PAR-CLIP	20371350
MIRT567742	hsa-miR-5693	PAR-CLIP	20371350
MIRT567741	hsa-miR-194-3p	PAR-CLIP	20371350
MIRT567740	hsa-miR-4766-5p	PAR-CLIP	20371350
MIRT567739	hsa-miR-496	PAR-CLIP	20371350
MIRT567738	hsa-let-7a-3p	PAR-CLIP	20371350
MIRT567737	hsa-let-7b-3p	PAR-CLIP	20371350
MIRT567736	hsa-let-7f-1-3p	PAR-CLIP	20371350
MIRT567735	hsa-miR-98-3p	PAR-CLIP	20371350
MIRT567734	hsa-miR-4789-5p	PAR-CLIP	20371350
MIRT567733	hsa-let-7f-2-3p	PAR-CLIP	20371350
MIRT567732	hsa-miR-1185-1-3p	PAR-CLIP	20371350
MIRT567731	hsa-miR-1185-2-3p	PAR-CLIP	20371350
MIRT494123	hsa-miR-4779	PAR-CLIP	23592263
MIRT494122	hsa-miR-6750-5p	PAR-CLIP	23592263
MIRT494121	hsa-miR-6822-5p	PAR-CLIP	23592263
MIRT494120	hsa-miR-4707-5p	PAR-CLIP	23592263
MIRT494118	hsa-miR-765	PAR-CLIP	23592263
MIRT494119	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT494117	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT494116	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT494115	hsa-miR-6781-5p	PAR-CLIP	23592263
MIRT567747	hsa-miR-551b-5p	PAR-CLIP	20371350
MIRT567746	hsa-miR-300	PAR-CLIP	20371350
MIRT567745	hsa-miR-381-3p	PAR-CLIP	20371350
MIRT567744	hsa-miR-4666a-3p	PAR-CLIP	20371350
MIRT567743	hsa-miR-5094	PAR-CLIP	20371350
MIRT567742	hsa-miR-5693	PAR-CLIP	20371350
MIRT567741	hsa-miR-194-3p	PAR-CLIP	20371350
MIRT567740	hsa-miR-4766-5p	PAR-CLIP	20371350
MIRT567739	hsa-miR-496	PAR-CLIP	20371350
MIRT567738	hsa-let-7a-3p	PAR-CLIP	20371350
MIRT567737	hsa-let-7b-3p	PAR-CLIP	20371350
MIRT567736	hsa-let-7f-1-3p	PAR-CLIP	20371350
MIRT567735	hsa-miR-98-3p	PAR-CLIP	20371350
MIRT567734	hsa-miR-4789-5p	PAR-CLIP	20371350
MIRT567733	hsa-let-7f-2-3p	PAR-CLIP	20371350
MIRT567732	hsa-miR-1185-1-3p	PAR-CLIP	20371350
MIRT567731	hsa-miR-1185-2-3p	PAR-CLIP	20371350
MIRT494123	hsa-miR-4779	PAR-CLIP	23592263
MIRT494122	hsa-miR-6750-5p	PAR-CLIP	23592263
MIRT494121	hsa-miR-6822-5p	PAR-CLIP	23592263
MIRT494120	hsa-miR-4707-5p	PAR-CLIP	23592263
MIRT494118	hsa-miR-765	PAR-CLIP	23592263
MIRT494119	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT494117	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT494116	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT494115	hsa-miR-6781-5p	PAR-CLIP	23592263
MIRT938917	hsa-miR-124	CLIP-seq
MIRT938918	hsa-miR-1305	CLIP-seq
MIRT938919	hsa-miR-199a-3p	CLIP-seq
MIRT938920	hsa-miR-199b-3p	CLIP-seq
MIRT938921	hsa-miR-203	CLIP-seq
MIRT938922	hsa-miR-21	CLIP-seq
MIRT938923	hsa-miR-299-5p	CLIP-seq
MIRT938924	hsa-miR-3129-5p	CLIP-seq
MIRT938925	hsa-miR-3613-3p	CLIP-seq
MIRT938926	hsa-miR-3662	CLIP-seq
MIRT938927	hsa-miR-4307	CLIP-seq
MIRT938928	hsa-miR-4328	CLIP-seq
MIRT938929	hsa-miR-4418	CLIP-seq
MIRT938930	hsa-miR-4663	CLIP-seq
MIRT938931	hsa-miR-4698	CLIP-seq
MIRT938932	hsa-miR-4775	CLIP-seq
MIRT938933	hsa-miR-506	CLIP-seq
MIRT938934	hsa-miR-509-3-5p	CLIP-seq
MIRT938935	hsa-miR-509-5p	CLIP-seq
MIRT938936	hsa-miR-5096	CLIP-seq
MIRT938937	hsa-miR-520d-5p	CLIP-seq
MIRT938938	hsa-miR-524-5p	CLIP-seq
MIRT938939	hsa-miR-548an	CLIP-seq
MIRT938940	hsa-miR-548g	CLIP-seq
MIRT938941	hsa-miR-590-5p	CLIP-seq
MIRT938942	hsa-miR-628-5p	CLIP-seq
MIRT938943	hsa-miR-629	CLIP-seq
MIRT938944	hsa-miR-637	CLIP-seq
MIRT938945	hsa-miR-936	CLIP-seq
MIRT938946	hsa-miR-95	CLIP-seq
MIRT1977772	hsa-miR-1292	CLIP-seq
MIRT1977773	hsa-miR-4446-3p	CLIP-seq
MIRT1977774	hsa-miR-4471	CLIP-seq
MIRT1977775	hsa-miR-4492	CLIP-seq
MIRT1977776	hsa-miR-4498	CLIP-seq
MIRT1977777	hsa-miR-4505	CLIP-seq
MIRT1977778	hsa-miR-4646-5p	CLIP-seq
MIRT1977779	hsa-miR-4721	CLIP-seq
MIRT1977780	hsa-miR-762	CLIP-seq
MIRT938926	hsa-miR-3662	CLIP-seq
MIRT938931	hsa-miR-4698	CLIP-seq
MIRT938946	hsa-miR-95	CLIP-seq
MIRT938937	hsa-miR-520d-5p	CLIP-seq
MIRT938938	hsa-miR-524-5p	CLIP-seq
MIRT2516947	hsa-miR-3657	CLIP-seq
MIRT2516948	hsa-miR-3664-5p	CLIP-seq
MIRT2516949	hsa-miR-3691-3p	CLIP-seq
MIRT2516950	hsa-miR-4645-5p	CLIP-seq
MIRT2516951	hsa-miR-4669	CLIP-seq
MIRT2516952	hsa-miR-4673	CLIP-seq
MIRT2516953	hsa-miR-4699-3p	CLIP-seq
MIRT938937	hsa-miR-520d-5p	CLIP-seq
MIRT938938	hsa-miR-524-5p	CLIP-seq
MIRT2679305	hsa-miR-3140-5p	CLIP-seq
MIRT2516947	hsa-miR-3657	CLIP-seq
MIRT2516948	hsa-miR-3664-5p	CLIP-seq
MIRT2516949	hsa-miR-3691-3p	CLIP-seq
MIRT2679306	hsa-miR-4427	CLIP-seq
MIRT2516950	hsa-miR-4645-5p	CLIP-seq
MIRT2516951	hsa-miR-4669	CLIP-seq
MIRT2516952	hsa-miR-4673	CLIP-seq
MIRT2516953	hsa-miR-4699-3p	CLIP-seq
MIRT2679307	hsa-miR-500a	CLIP-seq
MIRT938937	hsa-miR-520d-5p	CLIP-seq
MIRT938938	hsa-miR-524-5p	CLIP-seq

Show/Hide all(32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA	21873635
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	1354641
GO:0003727	Function	Single-stranded RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	25416956
GO:0005634	Component	Nucleus	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0007420	Process	Brain development	TAS	7590232
GO:0009790	Process	Embryo development	IBA	21873635
GO:0009954	Process	Proximal/distal pattern formation	IEA
GO:0021544	Process	Subpallium development	IEA
GO:0021766	Process	Hippocampus development	IEA
GO:0021772	Process	Olfactory bulb development	IEA
GO:0021879	Process	Forebrain neuron differentiation	IEA
GO:0021893	Process	Cerebral cortex GABAergic interneuron fate commitment	IEA
GO:0030154	Process	Cell differentiation	IBA	21873635
GO:0042475	Process	Odontogenesis of dentin-containing tooth	IEA
GO:0045597	Process	Positive regulation of cell differentiation	ISS
GO:0045746	Process	Negative regulation of Notch signaling pathway	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046533	Process	Negative regulation of photoreceptor cell differentiation	ISS
GO:0048701	Process	Embryonic cranial skeleton morphogenesis	IEA
GO:0048715	Process	Negative regulation of oligodendrocyte differentiation	IEA
GO:0048755	Process	Branching morphogenesis of a nerve	IEA
GO:0051216	Process	Cartilage development	IEA
GO:1902871	Process	Positive regulation of amacrine cell differentiation	ISS
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
126255	2915	ENSG00000115844

Protein

UniProt ID

Q07687

Protein name

Homeobox protein DLX-2

Protein function

Acts as a transcriptional activator (By similarity). Activates transcription of CGA/alpha-GSU, via binding to the downstream activin regulatory element (DARE) in the gene promoter (By similarity). Plays a role in terminal differentiation of inte

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12413	DLL_N	51 → 132	Homeobox protein distal-less-like N terminal	Family
PF00046	Homeodomain	153 → 209	Homeodomain	Domain

Sequence

MTGVFDSLVADMHSTQIAASSTYHQHQQPPSGGGAGPGGNSSSSSSLHKPQESPTLPVST
ATDSSYYTNQQHPAGGGGGGGSPYAHMGSYQYQASGLNNVPYSAKSSYDLGYTAAYTSYA
PYGTSSSPANNEPEKEDLEPEIRIVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALP
ERAELAASLGLTQTQVKIWFQNRRSKFKKMWKSGEIPSEQHPGASASPPCASPPVSAPAS
WDFGVPQRMAGGGGPGSGGSGAGSSGSSPSSAASAFLGNYPWYHQTSGSASHLQATAPLL
HPTQTPQPHHHHHHHGGGGAPVSAGTIF

Sequence length

328

Interactions

View interactions

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Autism	Autistic Disorder	rs121964908, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699 View all (8 more)	18728693

Show/Hide Unknown Diseases (3)

Disease term	Disease name	Evidence	Source
Unknown
Schizophrenia	Schizophrenia		GWAS
Breast cancer	Breast cancer	Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients	GWAS, CBGDA
Carcinoma	Carcinoma		GWAS

Show/Hide Text Mining Associations (21)

Disease Name	Relationship Type	References
Associations from Text Mining
Astrocytoma	Associate	20233874
Autism Spectrum Disorder	Associate	18728693
Autistic Disorder	Associate	18728693
Autoimmune Diseases	Associate	36317140
Carcinoma Hepatocellular	Associate	31059056
Carcinoma Renal Cell	Associate	36344906
Carcinoma Squamous Cell	Associate	36317140
Colorectal Neoplasms	Associate	34789836
Hematologic Neoplasms	Associate	26799321
Immune System Diseases	Stimulate	36317140
Intracranial Aneurysm	Associate	37286519
Keloid	Associate	35047146
Lymphatic Metastasis	Associate	23674878
Melanoma	Associate	26489459
Necrosis	Associate	21917150
Neoplasm Metastasis	Associate	27336609, 28796261
Neoplasms	Associate	20233874, 21169070, 21917150, 26799321, 27336609, 28796261, 36317140
Odontogenic Tumors	Associate	36344906
Osteosarcoma	Associate	40389469
Prostatic Neoplasms	Associate	27336609
Stomach Neoplasms	Associate	23674878

DLX2 (distal-less homeobox 2)