Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1745
Gene name Gene Name - the full gene name approved by the HGNC.	Distal-less homeobox 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DLX1
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q31.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein is localized to the nucleus where it may function as a transcriptional regulator of signals from multiple TGF-{beta}

Show/Hide all(110)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016270	hsa-miR-193b-3p	Microarray	20304954
MIRT439130	hsa-miR-10b-5p	3'LIFE	25074381
MIRT439130	hsa-miR-10b-5p	3'LIFE	25074381
MIRT938876	hsa-miR-1256	CLIP-seq
MIRT938877	hsa-miR-1293	CLIP-seq
MIRT938878	hsa-miR-134	CLIP-seq
MIRT938879	hsa-miR-147b	CLIP-seq
MIRT938880	hsa-miR-19a	CLIP-seq
MIRT938881	hsa-miR-19b	CLIP-seq
MIRT938882	hsa-miR-210	CLIP-seq
MIRT938883	hsa-miR-23a	CLIP-seq
MIRT938884	hsa-miR-23b	CLIP-seq
MIRT938885	hsa-miR-23c	CLIP-seq
MIRT938886	hsa-miR-30a	CLIP-seq
MIRT938887	hsa-miR-30b	CLIP-seq
MIRT938888	hsa-miR-30c	CLIP-seq
MIRT938889	hsa-miR-30d	CLIP-seq
MIRT938890	hsa-miR-30e	CLIP-seq
MIRT938891	hsa-miR-3118	CLIP-seq
MIRT938892	hsa-miR-3127-5p	CLIP-seq
MIRT938893	hsa-miR-320a	CLIP-seq
MIRT938894	hsa-miR-320b	CLIP-seq
MIRT938895	hsa-miR-320c	CLIP-seq
MIRT938896	hsa-miR-320d	CLIP-seq
MIRT938897	hsa-miR-3613-5p	CLIP-seq
MIRT938898	hsa-miR-4429	CLIP-seq
MIRT938899	hsa-miR-4445	CLIP-seq
MIRT938900	hsa-miR-4483	CLIP-seq
MIRT938901	hsa-miR-4778-5p	CLIP-seq
MIRT938902	hsa-miR-511	CLIP-seq
MIRT938903	hsa-miR-548a-5p	CLIP-seq
MIRT938904	hsa-miR-548ab	CLIP-seq
MIRT938905	hsa-miR-548ak	CLIP-seq
MIRT938906	hsa-miR-548b-5p	CLIP-seq
MIRT938907	hsa-miR-548c-5p	CLIP-seq
MIRT938908	hsa-miR-548d-5p	CLIP-seq
MIRT938909	hsa-miR-548h	CLIP-seq
MIRT938910	hsa-miR-548i	CLIP-seq
MIRT938911	hsa-miR-548j	CLIP-seq
MIRT938912	hsa-miR-548k	CLIP-seq
MIRT938913	hsa-miR-548l	CLIP-seq
MIRT938914	hsa-miR-548w	CLIP-seq
MIRT938915	hsa-miR-548y	CLIP-seq
MIRT938916	hsa-miR-559	CLIP-seq
MIRT938877	hsa-miR-1293	CLIP-seq
MIRT938878	hsa-miR-134	CLIP-seq
MIRT938879	hsa-miR-147b	CLIP-seq
MIRT938882	hsa-miR-210	CLIP-seq
MIRT938891	hsa-miR-3118	CLIP-seq
MIRT938892	hsa-miR-3127-5p	CLIP-seq
MIRT938900	hsa-miR-4483	CLIP-seq
MIRT938877	hsa-miR-1293	CLIP-seq
MIRT938878	hsa-miR-134	CLIP-seq
MIRT938879	hsa-miR-147b	CLIP-seq
MIRT938882	hsa-miR-210	CLIP-seq
MIRT938891	hsa-miR-3118	CLIP-seq
MIRT938892	hsa-miR-3127-5p	CLIP-seq
MIRT938900	hsa-miR-4483	CLIP-seq
MIRT1977768	hsa-miR-3937	CLIP-seq
MIRT1977769	hsa-miR-4469	CLIP-seq
MIRT1977770	hsa-miR-513c	CLIP-seq
MIRT1977771	hsa-miR-514b-5p	CLIP-seq
MIRT938877	hsa-miR-1293	CLIP-seq
MIRT938878	hsa-miR-134	CLIP-seq
MIRT938879	hsa-miR-147b	CLIP-seq
MIRT938882	hsa-miR-210	CLIP-seq
MIRT938891	hsa-miR-3118	CLIP-seq
MIRT938892	hsa-miR-3127-5p	CLIP-seq
MIRT938900	hsa-miR-4483	CLIP-seq
MIRT938877	hsa-miR-1293	CLIP-seq
MIRT938878	hsa-miR-134	CLIP-seq
MIRT938879	hsa-miR-147b	CLIP-seq
MIRT938882	hsa-miR-210	CLIP-seq
MIRT938891	hsa-miR-3118	CLIP-seq
MIRT938892	hsa-miR-3127-5p	CLIP-seq
MIRT938900	hsa-miR-4483	CLIP-seq
MIRT2448313	hsa-miR-1200	CLIP-seq
MIRT938876	hsa-miR-1256	CLIP-seq
MIRT2448314	hsa-miR-1276	CLIP-seq
MIRT2448315	hsa-miR-188-3p	CLIP-seq
MIRT2448316	hsa-miR-2052	CLIP-seq
MIRT2448317	hsa-miR-2114	CLIP-seq
MIRT2448318	hsa-miR-3074-5p	CLIP-seq
MIRT2448319	hsa-miR-3140-3p	CLIP-seq
MIRT938893	hsa-miR-320a	CLIP-seq
MIRT938894	hsa-miR-320b	CLIP-seq
MIRT938895	hsa-miR-320c	CLIP-seq
MIRT938896	hsa-miR-320d	CLIP-seq
MIRT2448320	hsa-miR-330-3p	CLIP-seq
MIRT938897	hsa-miR-3613-5p	CLIP-seq
MIRT2448321	hsa-miR-3621	CLIP-seq
MIRT2448322	hsa-miR-371-5p	CLIP-seq
MIRT2448323	hsa-miR-371b-5p	CLIP-seq
MIRT2448324	hsa-miR-3942-5p	CLIP-seq
MIRT2448325	hsa-miR-4428	CLIP-seq
MIRT938898	hsa-miR-4429	CLIP-seq
MIRT2448326	hsa-miR-4436a	CLIP-seq
MIRT938899	hsa-miR-4445	CLIP-seq
MIRT2448327	hsa-miR-4446-5p	CLIP-seq
MIRT2448328	hsa-miR-4699-3p	CLIP-seq
MIRT2448329	hsa-miR-4700-3p	CLIP-seq
MIRT2448330	hsa-miR-4703-5p	CLIP-seq
MIRT2448331	hsa-miR-4768-3p	CLIP-seq
MIRT938901	hsa-miR-4778-5p	CLIP-seq
MIRT2448332	hsa-miR-493	CLIP-seq
MIRT938902	hsa-miR-511	CLIP-seq
MIRT2448333	hsa-miR-520d-5p	CLIP-seq
MIRT2448334	hsa-miR-524-5p	CLIP-seq
MIRT2448335	hsa-miR-548p	CLIP-seq
MIRT2448336	hsa-miR-561	CLIP-seq

Show/Hide all(32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA	21873635
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	14671321
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0003682	Function	Chromatin binding	IEA
GO:0005515	Function	Protein binding	IPI	14671321
GO:0005634	Component	Nucleus	IDA	14671321
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0009790	Process	Embryo development	IBA	21873635
GO:0009954	Process	Proximal/distal pattern formation	IEA
GO:0021544	Process	Subpallium development	IEA
GO:0021766	Process	Hippocampus development	IEA
GO:0021879	Process	Forebrain neuron differentiation	IEA
GO:0021893	Process	Cerebral cortex GABAergic interneuron fate commitment	IEA
GO:0030154	Process	Cell differentiation	IBA	21873635
GO:0030514	Process	Negative regulation of BMP signaling pathway	IMP	14671321
GO:0042475	Process	Odontogenesis of dentin-containing tooth	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0045597	Process	Positive regulation of cell differentiation	ISS
GO:0045746	Process	Negative regulation of Notch signaling pathway	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	14671321
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046533	Process	Negative regulation of photoreceptor cell differentiation	ISS
GO:0048706	Process	Embryonic skeletal system development	IEA
GO:0048715	Process	Negative regulation of oligodendrocyte differentiation	IEA
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IMP	14671321
GO:0071773	Process	Cellular response to BMP stimulus	IMP	14671321
GO:1902871	Process	Positive regulation of amacrine cell differentiation	ISS
GO:1903845	Process	Negative regulation of cellular response to transforming growth factor beta stimulus	IMP	14671321
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
600029	2914	ENSG00000144355

Protein

UniProt ID

P56177

Protein name

Homeobox protein DLX-1

Protein function

Plays a role as a transcriptional activator or repressor (PubMed:14671321). Inhibits several cytokine signaling pathways, such as TGFB1, activin-A/INHBA and BMP4 by interfering with the transcriptional stimulatory activity of transcription facto

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00046	Homeodomain	129 → 185	Homeodomain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in hematopoietic cell lines. {ECO:0000269|PubMed:14671321}.

Sequence

MTMTTMPESLNSPVSGKAVFMEFGPPNQQMSPSPMSHGHYSMHCLHSAGHSQPDGAYSSA
SSFSRPLGYPYVNSVSSHASSPYISSVQSYPGSASLAQSRLEDPGADSEKSTVVEGGEVR
FNGKGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKR
SKFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGGNAGSYIPSYTSW
YPSAHQEAMQQPQLM

Sequence length

255

Interactions

View interactions

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Autism spectrum disorder	Autism Spectrum Disorders	rs724159978, rs75184679, rs119103221, rs9332964, rs121912562, rs1594344233, rs727504317, rs111033204, rs1801086, rs587784464, rs724159948, rs764659822, rs794727977, rs796052733, rs796052728 View all (51 more)	21302352
Autism	Autistic Disorder	rs121964908, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699 View all (8 more)	18728693
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	12963668

Show/Hide Text Mining Associations (15)

Disease Name	Relationship Type	References
Associations from Text Mining
Anodontia	Associate	23549991
Autism Spectrum Disorder	Associate	18728693, 21302352
Autistic Disorder	Associate	18728693, 21302352
Drug Related Side Effects and Adverse Reactions	Associate	27196083
Frontotemporal Lobar Degeneration	Associate	37508584
Heart Arrest	Associate	27196083
Leukemia Lymphocytic Chronic B Cell	Associate	20484983
Lymphoma B Cell	Associate	30308041
Neoplasms	Associate	20233874
Neoplasms	Inhibit	36803573
Prostatic Neoplasms	Associate	23840433, 27196083, 27833659, 31783839, 33740948
Prostatitis	Associate	27833659
Schizophrenia	Associate	28321286
Supranuclear Palsy Progressive	Associate	30050033
Uterine Cervical Neoplasms	Associate	24647315, 36803573

DLX1 (distal-less homeobox 1)