Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1745
Gene name Gene Name - the full gene name approved by the HGNC.
Distal-less homeobox 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DLX1
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q31.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein is localized to the nucleus where it may function as a transcriptional regulator of signals from multiple TGF-{beta}
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016270 hsa-miR-193b-3p Microarray 20304954
MIRT439130 hsa-miR-10b-5p 3'LIFE 25074381
MIRT439130 hsa-miR-10b-5p 3'LIFE 25074381
MIRT938876 hsa-miR-1256 CLIP-seq
MIRT938877 hsa-miR-1293 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IMP 14671321
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IEA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600029 2914 ENSG00000144355
Protein
UniProt ID P56177
Protein name Homeobox protein DLX-1
Protein function Plays a role as a transcriptional activator or repressor (PubMed:14671321). Inhibits several cytokine signaling pathways, such as TGFB1, activin-A/INHBA and BMP4 by interfering with the transcriptional stimulatory activity of transcription facto
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 129 185 Homeodomain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in hematopoietic cell lines. {ECO:0000269|PubMed:14671321}.
Sequence
MTMTTMPESLNSPVSGKAVFMEFGPPNQQMSPSPMSHGHYSMHCLHSAGHSQPDGAYSSA
SSFSRPLGYPYVNSVSSHASSPYISSVQSYPGSASLAQSRLEDPGADSEKSTVVEGGEVR
FNGKGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKR
SKFKK
LMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGGNAGSYIPSYTSW
YPSAHQEAMQQPQLM
Sequence length 255
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Schizophrenia Schizophrenia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Anodontia Associate 23549991
Autism Spectrum Disorder Associate 18728693, 21302352
Autistic Disorder Associate 18728693, 21302352
Drug Related Side Effects and Adverse Reactions Associate 27196083
Frontotemporal Lobar Degeneration Associate 37508584
Heart Arrest Associate 27196083
Leukemia Lymphocytic Chronic B Cell Associate 20484983
Lymphoma B Cell Associate 30308041
Neoplasms Associate 20233874
Neoplasms Inhibit 36803573